Programs & Examples On #Basic

Short for Dimension. It's a type of variable. You declare (or "tell" Visual Basic) that you are setting up a variable with this word.

slices to the rescue :)

def left(s, amount):
    return s[:amount]

def right(s, amount):
    return s[-amount:]

def mid(s, offset, amount):
    return s[offset:offset+amount]

git fetch --all && git reset --hard origin/master && git pull

Something like this lets you test your procedure on almost any client:

DECLARE 
  v_cur SYS_REFCURSOR;
  v_a   VARCHAR2(10);
  v_b   VARCHAR2(10);
BEGIN
  your_proc(v_cur);

  LOOP
    FETCH v_cur INTO v_a, v_b;
    EXIT WHEN v_cur%NOTFOUND;
    dbms_output.put_line(v_a || ' ' || v_b);
  END LOOP;
  CLOSE v_cur;
END;

Basically, your test harness needs to support the definition of a SYS_REFCURSOR variable and the ability to call your procedure while passing in the variable you defined, then loop through the cursor result set. PL/SQL does all that, and anonymous blocks are easy to set up and maintain, fairly adaptable, and quite readable to anyone who works with PL/SQL.

Another, albeit similar way would be to build a named procedure that does the same thing, and assuming the client has a debugger (like SQL Developer, PL/SQL Developer, TOAD, etc.) you could then step through the execution.

var isiOSSafari = (navigator.userAgent.match(/like Mac OS X/i)) ? true: false;

Swift 4.0

Store:

let arrayFruit = ["Apple","Banana","Orange","Grapes","Watermelon"]    

 //store in user default
 UserDefaults.standard.set(arrayFruit, forKey: "arrayFruit")

Fetch:

if let arr = UserDefaults.standard.array(forKey: "arrayFruit") as? [String]{
        print(arr)
    }

in Kotlin 1.3

 val readTextFromUser = (findViewById(R.id.inputedText) as EditText).text.toString()

This will read the current text that the user has typed on the UI screen

Java 8 now allows implementation of methods inside an interface itself with default scope (and static only).

Sum of arithmetical progression

(A1+AN)/2*N = (1 + (N-1))/2*(N-1) = N*(N-1)/2

SELECT *, 1 AS sort_order
  FROM table1
 EXCEPT 
SELECT *, 1 AS sort_order
  FROM table2
UNION
SELECT *, 1 AS sort_order
  FROM table1
 INTERSECT 
SELECT *, 1 AS sort_order
  FROM table2
UNION
SELECT *, 2 AS sort_order
  FROM table2
 EXCEPT 
SELECT *, 2 AS sort_order
  FROM table1
ORDER BY sort_order;

But the real answer is: other than the ORDER BY clause, the sort order will by arbitrary and not guaranteed.

I used the below. The genre element will start where the DJ element ends,

<div>
<div style="width:50%; float:left">DJ</div>
<div>genre</div>
</div>

pardon the inline css.

This error means that the value indexed by the key "l_messages" is not of type hash, but rather something else. You've probably set it to that other value earlier in your code. Try various other value-getter commands, starting with GET, to see which one works and you'll know what type is actually here.

It's generally considered a bad idea to ignore exceptions. Usually, if it's appropriate, you want to either notify the user of the issue (if they would care) or at the very least, log the exception, or print the stack trace to the console.

However, if that's truly not necessary (you're the one making the decision) then no, there's no other way to ignore an exception that forces you to catch it. The only revision, in that case, that I would suggest is explicitly listing the the class of the Exceptions you're ignoring, and some comment as to why you're ignoring them, rather than simply ignoring any exception, as you've done in your example.

There are a few ways to get all unique combinations of a set of factors.

with(df, interaction(yad, per, drop=TRUE))   # gives labels
with(df, yad:per)                            # ditto

aggregate(numeric(nrow(df)), df[c("yad", "per")], length)    # gives a data frame

path.resolve('.') is also a reliable and clean option, because we almost always require('path'). It will give you absolute path of the directory from where it is called.

One thing you should be aware of when using each is that it has the side effect of adding "state" to your hash (the hash has to remember what the "next" key is). When using code like the snippets posted above, which iterate over the whole hash in one go, this is usually not a problem. However, you will run into hard to track down problems (I speak from experience ;), when using each together with statements like last or return to exit from the while ... each loop before you have processed all keys.

In this case, the hash will remember which keys it has already returned, and when you use each on it the next time (maybe in a totaly unrelated piece of code), it will continue at this position.

Example:

my %hash = ( foo => 1, bar => 2, baz => 3, quux => 4 );

# find key 'baz'
while ( my ($k, $v) = each %hash ) {
    print "found key $k\n";
    last if $k eq 'baz'; # found it!
}

# later ...

print "the hash contains:\n";

# iterate over all keys:
while ( my ($k, $v) = each %hash ) {
    print "$k => $v\n";
}

This prints:

found key bar
found key baz
the hash contains:
quux => 4
foo => 1

What happened to keys "bar" and baz"? They're still there, but the second each starts where the first one left off, and stops when it reaches the end of the hash, so we never see them in the second loop.

In my case, this error occur when i tried to use gridView

I resolved it by removing this line from build.grade(Module) file

implementation 'com.android.support:gridlayout-v7:28.0.0-alpha3'

This also works:

    ...
    WHERE
        (FirstName IS NULL OR FirstName = ISNULL(@FirstName, FirstName)) AND
        (LastName IS NULL OR LastName = ISNULL(@LastName, LastName)) AND
        (Title IS NULL OR Title = ISNULL(@Title, Title))

This is working code

protected void Page_Load(object sender, EventArgs e)
        {
            if (!Page.IsPostBack)
            { 
                    DropDownList1.DataTextField = "user_name";
                    DropDownList1.DataValueField = "user_id";
                    DropDownList1.DataSource = getData();// get the data into the list you can set it
                    DropDownList1.DataBind();

    DropDownList1.SelectedIndex = DropDownList1.Items.IndexOf(DropDownList1.Items.FindByText("your default selected text"));
            }
        }

Use a Comparator like this:

List<Fruit> fruits= new ArrayList<Fruit>();

Fruit fruit;
for(int i = 0; i < 100; i++)
{
  fruit = new Fruit();
  fruit.setname(...);
  fruits.add(fruit);
}

// Sorting
Collections.sort(fruits, new Comparator<Fruit>() {
        @Override
        public int compare(Fruit fruit2, Fruit fruit1)
        {

            return  fruit1.fruitName.compareTo(fruit2.fruitName);
        }
    });

Now your fruits list is sorted based on fruitName.

Remember to commit your changes before pushing to Github repo. This might fix your problem.

I did a project on this. You can look at my github repo:

https://github.com/nishant-boro/django-rest-framework-download-expert

This module provides a simple way to serve files for download in django rest framework using Apache module Xsendfile. It also has an additional feature of serving downloads only to users belonging to a particular group

If your variable is an argument, you can simply use %~dpn (for paths) or %~n (for names only) followed by the argument number, so you don't have to worry for varying extension lengths.

For instance %~dpn0 will return the path of the batch file without its extension, %~dpn1 will be %1 without extension, etc.

Whereas %~n0 will return the name of the batch file without its extension, %~n1 will be %1 without path and extension, etc.

The <ul> element has browser inherent padding & margin by default. In your case, Use

#footer ul {
    margin: 0; /* To remove default bottom margin */ 
    padding: 0; /* To remove default left padding */
}

or a CSS browser reset ( https://cssreset.com/ ) to deal with this.

Text will never wrap to the next line. The text continues on the same line until a
tag is encountered.

.dropdown-menu {
    white-space: nowrap;
}

There are multiple ways of doing that you can use either place or grid or even the packmethod.

Sample code:

from tkinter import *
root = Tk()

l = Label(root, text="hello" )
l.pack(padx=6, pady=4) # where padx and pady represent the x and y axis respectively
# well you can also use side=LEFT inside the pack method of the label widget.

To place a widget to on basis of columns and rows , use the grid method:

but = Button(root, text="hello" )
but.grid(row=0, column=1)

Simple and short answer to your question is

Please add following line into your "Execute shell" Build step.

#!/bin/sh

Now let me explain you the reason why we require this line for "Execute Shell" build job.

By default Jenkins take /bin/sh -xe and this means -x will print each and every command.And the other option -e, which causes shell to stop running a script immediately when any command exits with non-zero (when any command fails) exit code.

So by adding the #!/bin/sh will allow you to execute with no option.

an apache server is an http server which can serve any simple http requests, where tomcat server is actually a servlet container which can serve java servlet requests.

Web server [apache] process web client (web browsers) requests and forwards it to servlet container [tomcat] and container process the requests and sends response which gets forwarded by web server to the web client [browser].

Also you can check this link for more clarification:-

https://sites.google.com/site/sureshdevang/servlet-architecture

Also check this answer for further researching :-

https://softwareengineering.stackexchange.com/a/221092

Make certain to specify stringsAsFactors=FALSE when creating the dataframe:

> rm(list=ls())
> trigonometry <- data.frame(character(0), numeric(0), stringsAsFactors=FALSE)
> colnames(trigonometry) <- c("theta", "sin.theta")
> trigonometry
[1] theta     sin.theta
<0 rows> (or 0-length row.names)
> trigonometry[nrow(trigonometry) + 1, ] <- c("0", sin(0))
> trigonometry[nrow(trigonometry) + 1, ] <- c("pi/2", sin(pi/2))
> trigonometry
  theta sin.theta
1     0         0
2  pi/2         1
> typeof(trigonometry)
[1] "list"
> class(trigonometry)
[1] "data.frame"

Failing to use stringsAsFactors=FALSE when creating the dataframe will result in the following error when attempting to add the new row:

> trigonometry[nrow(trigonometry) + 1, ] <- c("0", sin(0))
Warning message:
In `[<-.factor`(`*tmp*`, iseq, value = "0") :
  invalid factor level, NA generated

ok i can run android from cordova, i changed ANDROID_HOME to,

export ANDROID_HOME=/usr/local/opt/android-sdk

declare @starttime datetime = '2012-03-07 22:58:00'

SELECT BookingId, StartTime
FROM Booking
WHERE ABS( DATEDIFF( minute, StartTime, @starttime ) ) <= 60

You have to use new operator here to instantiate. For example:

Contacts.add(new Data(name, address, contact));

One way is to use re.subn. For example, to count the number of occurrences of 'hello' in any mix of cases you can do:

import re
_, count = re.subn(r'hello', '', astring, flags=re.I)
print('Found', count, 'occurrences of "hello"')

Adding to the other great answers, we can use the Python logging library's debug(), info(), warning(), error(), and critical() methods. Quoting from the docs for Python 3.7.4,

There are three keyword arguments in kwargs which are inspected: exc_info which, if it does not evaluate as false, causes exception information to be added to the logging message.

What this means is, you can use the Python logging library to output a debug(), or other type of message, and the logging library will include the stack trace in its output. With this in mind, we can do the following:

import logging

logger = logging.getLogger()
logger.setLevel(logging.DEBUG)

def f():
    a = { 'foo': None }
    # the following line will raise KeyError
    b = a['bar']

def g():
    f()

try:
    g()
except Exception as e:
    logger.error(str(e), exc_info=True)

And it will output:

'bar'
Traceback (most recent call last):
  File "<ipython-input-2-8ae09e08766b>", line 18, in <module>
    g()
  File "<ipython-input-2-8ae09e08766b>", line 14, in g
    f()
  File "<ipython-input-2-8ae09e08766b>", line 10, in f
    b = a['bar']
KeyError: 'bar'

declare @data as varchar(50)
set @data='ciao335'


--get text
Select Left(@Data, PatIndex('%[0-9]%', @Data + '1') - 1)    ---->>ciao

--get numeric
Select right(@Data, len(@data) - (PatIndex('%[0-9]%', @Data )-1) )   ---->>335

It should be like

params.permit(:id => [])

Also since rails version 4+ you can use:

params.permit(id: [])

I also had the similar requirement. Most of the examples on net are asking to create models and create forms which I did not wanna use. Here is my final code.

if request.method == 'POST':
    file1 = request.FILES['file']
    contentOfFile = file1.read()
    if file1:
        return render(request, 'blogapp/Statistics.html', {'file': file1, 'contentOfFile': contentOfFile})

And in HTML to upload I wrote:

{% block content %}
    <h1>File content</h1>
    <form action="{% url 'blogapp:uploadComplete'%}" method="post" enctype="multipart/form-data">
         {% csrf_token %}
        <input id="uploadbutton" type="file" value="Browse" name="file" accept="text/csv" />
        <input type="submit" value="Upload" />
    </form>
    {% endblock %}

Following is the HTML which displays content of file:

{% block content %}
    <h3>File uploaded successfully</h3>
    {{file.name}}
    </br>content = {{contentOfFile}}
{% endblock %}

If you want to do it with a Windows Store App, following by @Hans Kesting and @Jink answer:

    string colorcode = "#FFEEDDCC";
    int argb = Int32.Parse(colorcode.Replace("#", ""), NumberStyles.HexNumber);
    tData.DefaultData = Color.FromArgb((byte)((argb & -16777216) >> 0x18),
                          (byte)((argb & 0xff0000) >> 0x10),
                          (byte)((argb & 0xff00) >> 8),
                          (byte)(argb & 0xff));

Alter table Hotels 
Add  
{ 
 HasPhotoInReadyStorage  bit, 
 HasPhotoInWorkStorage  bit, 
 HasPhotoInMaterialStorage bit, 
 HasHotelPhotoInReadyStorage  bit, 
 HasHotelPhotoInWorkStorage  bit, 
 HasHotelPhotoInMaterialStorage bit, 
 HasReporterData  bit, 
 HasMovieInReadyStorage  bit, 
 HasMovieInWorkStorage  bit, 
 HasMovieInMaterialStorage bit 
}; 

Above you are using {, }.

Also, you are missing commas:

ALTER TABLE Regions 
ADD ( HasPhotoInReadyStorage  bit, 
 HasPhotoInWorkStorage  bit, 
 HasPhotoInMaterialStorage bit <**** comma needed here
 HasText  bit); 

You need to remove the brackets and make sure all columns have a comma where necessary.

//To clear When Clear Button is Clicked

firstName = (EditText) findViewById(R.id.firstName);

    clear = (Button) findViewById(R.id.clearsearchSubmit);

    clear.setOnClickListener(new OnClickListener() {

        @Override
        public void onClick(View v) {
            // TODO Auto-generated method stub
            if (v.getId() == R.id.clearsearchSubmit);
            firstName.setText("");
        }
    });

This will help to clear the wrong keywords that you have typed in so instead of pressing backspace again and again you can simply click the button to clear everything.It Worked For me. Hope It Helps

I received this error in my code because I'd not run JSON.parse(result).

So my result was a string instead of an array of objects.

i.e. I got:

"[{},{}]" 

instead of:

[{},{}]

import { Storage } from '@ionic/storage';
...
private static readonly SERVER = 'server';
...
getStorage(): Promise {
  return this.storage.get(LoginService.SERVER);
}
...
this.getStorage()
  .then((value) => {
     let servers: Server[] = JSON.parse(value) as Server[];
                   }
  );

Yes, it can be done as long as both windows are on the same domain. The window.open() function will return a handle to the new window. The child window can access the parent window using the DOM element "opener".

yum list installed | grep mysql

Then if it's not installed you can do (as root)

yum install mysql -y

You dont have to bind anything, Just use Arrow functions like this:

class Counter extends React.Component {
    constructor(props) {
        super(props);

        this.state = {
            count: 1
        };

    }
    //ARROW FUNCTION
    delta = () => {
        this.setState({
            count: this.state.count++
        });
    }

    render() {
        return (
            <div>
                <h1>{this.state.count}</h1>
                <button onClick={this.delta}>+</button>
            </div>
        );
    }
}

For the Germans:

you have to change your decimal commas into a Full stop in your csv-file (in Excel:File -> Options -> Advanced -> "Decimal seperator") , then the error is solved.

explode is an alternative. However, if you meant to split through a regular expression, the alternative is preg_split instead.

I would use underscore and take care of empty strings too:

var my_object = { a:undefined, b:2, c:4, d:undefined, k: null, p: false, s: '', z: 0 };_x000D_
_x000D_
var result =_.omit(my_object, function(value) {_x000D_
  return _.isUndefined(value) || _.isNull(value) || value === '';_x000D_
});_x000D_
_x000D_
console.log(result); //Object {b: 2, c: 4, p: false, z: 0}

jsbin.

The other individuals answered the question. I want to suggest you use a JTabbedPane instead of replacing content. As a general rule, it is bad to have visual elements of your application disappear or be replaced by other content. Certainly there are exceptions to every rule, and only you and your user community can decide the best approach.

You should add mode history to your router like the below

export default new Router({
  mode: 'history',
  routes: [
    {
     ...
    }
  ]
}) 

I would also trim the input field, cause a space could make it look like filled

if ($.trim($('#person_data[document_type]').val()) != '')
{

}

using DotNetZip (available as nuget package):

public void Zip(string source, string destination)
{
    using (ZipFile zip = new ZipFile
    {
        CompressionLevel = CompressionLevel.BestCompression
    })
    {
        var files = Directory.GetFiles(source, "*",
            SearchOption.AllDirectories).
            Where(f => Path.GetExtension(f).
                ToLowerInvariant() != ".zip").ToArray();

        foreach (var f in files)
        {
            zip.AddFile(f, GetCleanFolderName(source, f));
        }

        var destinationFilename = destination;

        if (Directory.Exists(destination) && !destination.EndsWith(".zip"))
        {
            destinationFilename += $"\\{new DirectoryInfo(source).Name}-{DateTime.Now:yyyy-MM-dd-HH-mm-ss-ffffff}.zip";
        }

        zip.Save(destinationFilename);
    }
}

private string GetCleanFolderName(string source, string filepath)
{
    if (string.IsNullOrWhiteSpace(filepath))
    {
        return string.Empty;
    }

    var result = filepath.Substring(source.Length);

    if (result.StartsWith("\\"))
    {
        result = result.Substring(1);
    }

    result = result.Substring(0, result.Length - new FileInfo(filepath).Name.Length);

    return result;
}

Usage:

Zip(@"c:\somefolder\subfolder\source", @"c:\somefolder2\subfolder2\dest");

Or

Zip(@"c:\somefolder\subfolder\source", @"c:\somefolder2\subfolder2\dest\output.zip");

INSERT INTO destination_table ( 
      Field_1, 
      Field_2, 
      Field_3) 
SELECT Field_1, 
      Field_2, 
      Field_3 
      FROM source_table;

BUT this is a BAD MYSQL

Do this instead:

1. drop the destination table: DROP DESTINATION_TABLE;
2. CREATE TABLE DESTINATION_TABLE AS (SELECT * FROM SOURCE_TABLE);

If you are using gradle. You can apply 'aplication' plugin and use the following command

  applicationDefaultJvmArgs = [
             "-Dlog4j.configurationFile=your.xml",
                              ]

The example you are using is wrong. See the man page for easy_setopt. In the example write_data uses its own FILE, *outfile, and not the fp that was specified in CURLOPT_WRITEDATA. That's why closing fp causes problems - it's not even opened.

This is more or less what it should look like (no libcurl available here to test)

#include <stdio.h>
#include <curl/curl.h>
/* For older cURL versions you will also need 
#include <curl/types.h>
#include <curl/easy.h>
*/
#include <string>

size_t write_data(void *ptr, size_t size, size_t nmemb, FILE *stream) {
    size_t written = fwrite(ptr, size, nmemb, stream);
    return written;
}

int main(void) {
    CURL *curl;
    FILE *fp;
    CURLcode res;
    char *url = "http://localhost/aaa.txt";
    char outfilename[FILENAME_MAX] = "C:\\bbb.txt";
    curl = curl_easy_init();
    if (curl) {
        fp = fopen(outfilename,"wb");
        curl_easy_setopt(curl, CURLOPT_URL, url);
        curl_easy_setopt(curl, CURLOPT_WRITEFUNCTION, write_data);
        curl_easy_setopt(curl, CURLOPT_WRITEDATA, fp);
        res = curl_easy_perform(curl);
        /* always cleanup */
        curl_easy_cleanup(curl);
        fclose(fp);
    }
    return 0;
}

Updated: as suggested by @rsethc types.h and easy.h aren't present in current cURL versions anymore.

Your code is failing on this line:

var RUnits = Math.abs(document.all.Capacity.RUnits.value);

i tried stepping though it with firebug and it fails there. that should help you figure out the problem.

you have jquery referenced. you might as well use it in all these functions. it'll clean up your code significantly.

Say you have array named list. The Splice() function can be used for both adding and removing item in that array in specific index i.e that can be in the beginning or in the end or at any index. On the contrary there are another function name shift() and pop() which is capable of removing only the first and last item in the array.

This is the Shift Function which is only capable of removing the first element of the array

var item = [ 1,1,2,3,5,8,13,21,34 ]; // say you have this number series 
item.shift(); // [ 1,2,3,5,8,13,21,34 ];

The Pop Function removes item from an array at its last index

item.pop(); // [ 1,2,3,5,8,13,21 ];

Now comes the splice function by which you can remove item at any index

item.slice(0,1); // [ 2,3,5,8,13,21 ] removes the first object
item.slice(item.length-1,1); // [ 2,3,5,8,13 ] removes the last object 

The slice function accepts two parameters (Index to start with, number of steps to go);

it pretty much depends on the relative sizes of the new string after every new concatenation. With the + operator, for every concatenation a new string is made. If the intermediary strings are relatively long, the + becomes increasingly slower because the new intermediary string is being stored.

Consider this case:

from time import time
stri=''
a='aagsdfghfhdyjddtyjdhmfghmfgsdgsdfgsdfsdfsdfsdfsdfsdfddsksarigqeirnvgsdfsdgfsdfgfg'
l=[]
#case 1
t=time()
for i in range(1000):
    stri=stri+a+repr(i)
print time()-t

#case 2
t=time()
for i in xrange(1000):
    l.append(a+repr(i))
z=''.join(l)
print time()-t

#case 3
t=time()
for i in range(1000):
    stri=stri+repr(i)
print time()-t

#case 4
t=time()
for i in xrange(1000):
    l.append(repr(i))
z=''.join(l)
print time()-t

Results

1 0.00493192672729

2 0.000509023666382

3 0.00042200088501

4 0.000482797622681

In the case of 1&2, we add a large string, and join() performs about 10 times faster. In case 3&4, we add a small string, and '+' performs slightly faster

  INSERT INTO Data ( Col1 ) VALUES ('Hello'), ('World')

A more "duck typing" way is to use respond_to? this way "integer-like" or "string-like" classes can also be used

if(s.respond_to?(:match) && s.match(".com")){
  puts "It's a .com"
else
  puts "It's not"
end

Descending order using underscore can be done by multiplying the return value by -1.

//Ascending Order:
_.sortBy([2, 3, 1], function(num){
    return num;
}); // [1, 2, 3]


//Descending Order:
_.sortBy([2, 3, 1], function(num){
    return num * -1;
}); // [3, 2, 1]

If you're sorting by strings not numbers, you can use the charCodeAt() method to get the unicode value.

//Descending Order Strings:
_.sortBy(['a', 'b', 'c'], function(s){ 
    return s.charCodeAt() * -1;
});

I watched one of the presentations of Brian Goetz (Java Language Architect & specification lead for Lambda Expressions). He explains in detail the following 4 points to consider before going for parallelization:

Splitting / decomposition costs
– Sometimes splitting is more expensive than just doing the work!
Task dispatch / management costs
– Can do a lot of work in the time it takes to hand work to another thread.
Result combination costs
– Sometimes combination involves copying lots of data. For example, adding numbers is cheap whereas merging sets is expensive.
Locality
– The elephant in the room. This is an important point which everyone may miss. You should consider cache misses, if a CPU waits for data because of cache misses then you wouldn't gain anything by parallelization. That's why array-based sources parallelize the best as the next indices (near the current index) are cached and there are fewer chances that CPU would experience a cache miss.

He also mentions a relatively simple formula to determine a chance of parallel speedup.

NQ Model:

N x Q > 10000

where,
N = number of data items
Q = amount of work per item

There are several tools all built around Xperf. It's rather complex but very powerful -- see the quick start guide. There are other useful resources on the Windows Performance Analysis page

You can vertically align a floated element in a way which works on IE 6+. It doesn't need full table markup either. This method isn't perfectly clean - includes wrappers and there are a few things to be aware of e.g. if you have too much text outspilling the container - but it's pretty good.

Short answer: You just need to apply display: table-cell to an element inside the floated element (table cells don't float), and use a fallback with position: absolute and top for old IE.

Long answer: Here's a jsfiddle showing the basics. The important stuff summarized (with a conditional comment adding an .old-ie class):

    .wrap {
        float: left;
        height: 100px; /* any fixed amount */
    }
    .wrap2 {
        height: inherit;
    }
    .content {
        display: table-cell;
        height: inherit;
        vertical-align: middle;
    }

    .old-ie .wrap{
        position: relative;
    }
    .old-ie .wrap2 {
        position: absolute;
        top: 50%;
    }
    .old-ie .content {
        position: relative;
        top: -50%;
        display: block;
    }

Here's a jsfiddle that deliberately highlight the minor faults with this method. Note how:

• In standards browsers, content that exceeds the height of the wrapper element stops centering and starts going down the page. This isn't a big problem (probably looks better than creeping up the page), and can be avoided by avoiding content that is too big (note that unless I've overlooked something, overflow methods like overflow: auto; don't seem to work)
• In old IE, the content element doesn't stretch to fill the available space - the height is the height of the content, not of the container.

Those are pretty minor limitations, but worth being aware of.

Code and idea adapted from here

If I'm not wrong, you can start your application using command line and thus also using a batch file. In that case it is not a very hard task to start it with Windows login.

You just create a batch file with the following content:

node C:\myapp.js

and save it with .bat extention. Here myapp.js is your app, which in this example is located in C: drive (spcify the path).

Now you can just throw the batch file in your startup folder which is located at C:\Users\%username%\AppData\Roaming\Microsoft\Windows\Start Menu\Programs\Startup

Just open it using %appdata% in run dailog box and locate to >Roaming>Microsoft>Windows>Start Menu>Programs>Startup

The batch file will be executed at login time and start your node application from cmd.

grep LMN20113456 LMN2011*

or if you want to search recursively through subdirectories:

find . -type f -name 'LMN2011*' -exec grep LMN20113456 {} \;

Yes it is possible. Assuming:

var data = {
    'PropertyA': 1,
    'PropertyB': 2,
    'PropertyC': 3
};
var propertyName = "someProperty";
var propertyValue = "someValue";

Either:

data[propertyName] = propertyValue;

or

eval("data." + propertyName + " = '" + propertyValue + "'");

The first method is preferred. eval() has the obvious security concerns if you're using values supplied by the user so don't use it if you can avoid it but it's worth knowing it exists and what it can do.

You can reference this with:

alert(data.someProperty);

or

data(data["someProperty"]);

or

alert(data[propertyName]);

Corrected the Fiddle - updated shows the Image duplicated into the Canvas...

And right click can be saved as a .PNG

http://jsfiddle.net/gfyWK/67/

<div style="text-align:center">
<img src="http://imgon.net/di-M7Z9.jpg" id="picture" style="display:none;" />
<br />
<div id="for_jcrop">here the image should apear</div>
<canvas id="rotate" style="border:5px double black; margin-top:5px; "></canvas>
</div>

Plus the JS on the fiddle page...

Cheers Si

Currently looking at saving this to File on the server --- ASP.net C# (.aspx web form page) Any advice would be cool....

In Angular 2+, try the @Input decorator

It allows for some nice property binding between parent and child components.

First create a global variable in the parent to hold the object/property that will be passed to the child.

Next create a global variable in the child to hold the object/property passed from the parent.

Then in the parent html, where the child template is used, add square brackets notation with the name of the child variable, then set it equal to the name of the parent variable. Example:

<child-component-template [childVariable] = parentVariable>
</child-component-template>

Finally, where the child property is defined in the child component, add the Input decorator:

@Input()
public childVariable: any

When your parent variable is updated, it should pass the updates to the child component, which will update its html.

Also, to trigger a function in the child component, take a look at ngOnChanges.

As someone who has written several libraries for consuming REST services, let me give you the client perspective on why I think wrapping the result in metadata is the way to go:

• Without the total count, how can the client know that it has not yet received everything there is and should continue paging through the result set? In a UI that didn't perform look ahead to the next page, in the worst case this might be represented as a Next/More link that didn't actually fetch any more data.
• Including metadata in the response allows the client to track less state. Now I don't have to match up my REST request with the response, as the response contains the metadata necessary to reconstruct the request state (in this case the cursor into the dataset).
• If the state is part of the response, I can perform multiple requests into the same dataset simultaneously, and I can handle the requests in any order they happen to arrive in which is not necessarily the order I made the requests in.

And a suggestion: Like the Twitter API, you should replace the page_number with a straight index/cursor. The reason is, the API allows the client to set the page size per-request. Is the returned page_number the number of pages the client has requested so far, or the number of the page given the last used page_size (almost certainly the later, but why not avoid such ambiguity altogether)?

Array initializer support for type inference were changed in Visual Basic 10 vs Visual Basic 9.

In previous version of VB it was required to put empty parens to signify an array. Also, it would define the array as object array unless otherwise was stated:

' Integer array
Dim i as Integer() = {1, 2, 3, 4} 

' Object array
Dim o() = {1, 2, 3} 

Check more info:

Visual Basic 2010 Breaking Changes

Collection and Array Initializers in Visual Basic 2010

That seems a rather weird design for your code - it generally makes more sense to have your functions called directly from a .js file, and then only retrieve data with the Ajax call.

However, I believe it should work by calling eval() on the response - provided it is syntactically correct JavaScript code.

Following is the code to find email id, name and profile url etc

    private CallbackManager callbackManager;

    protected void onCreate(Bundle savedInstanceState) {
            super.onCreate(savedInstanceState);
            setContentView(R.layout.activity_sign_in);
//TODO on click of fb custom button call handleFBLogin()
     callbackManager = CallbackManager.Factory.create();
    }

    private void handleFBLogin() {
            AccessToken accessToken = AccessToken.getCurrentAccessToken();
            boolean isLoggedIn = accessToken != null && !accessToken.isExpired();

            if (isLoggedIn && Store.isUserExists(ActivitySignIn.this)) {
                goToHome();
                return;
            }

            LoginManager.getInstance().logInWithReadPermissions(ActivitySignIn.this, Arrays.asList("public_profile", "email"));
            LoginManager.getInstance().registerCallback(callbackManager,
                    new FacebookCallback<LoginResult>() {
                        @Override
                        public void onSuccess(final LoginResult loginResult) {
                            runOnUiThread(new Runnable() {
                                @Override
                                public void run() {
                                    setFacebookData(loginResult);
                                }
                            });
                        }

                        @Override
                        public void onCancel() {
                            Toast.makeText(ActivitySignIn.this, "CANCELED", Toast.LENGTH_SHORT).show();
                        }

                        @Override
                        public void onError(FacebookException exception) {
                            Toast.makeText(ActivitySignIn.this, "ERROR" + exception.toString(), Toast.LENGTH_SHORT).show();
                        }
                    });
        }

private void setFacebookData(final LoginResult loginResult) {
        GraphRequest request = GraphRequest.newMeRequest(
                loginResult.getAccessToken(),
                new GraphRequest.GraphJSONObjectCallback() {
                    @Override
                    public void onCompleted(JSONObject object, GraphResponse response) {
                        // Application code
                        try {
                            Log.i("Response", response.toString());

                            String email = response.getJSONObject().getString("email");
                            String firstName = response.getJSONObject().getString("first_name");
                            String lastName = response.getJSONObject().getString("last_name");
                            String profileURL = "";
                            if (Profile.getCurrentProfile() != null) {
                                profileURL = ImageRequest.getProfilePictureUri(Profile.getCurrentProfile().getId(), 400, 400).toString();
                            }

                           //TODO put your code here
                        } catch (JSONException e) {
                            Toast.makeText(ActivitySignIn.this, R.string.error_occurred_try_again, Toast.LENGTH_SHORT).show();
                        }
                    }
                });
        Bundle parameters = new Bundle();
        parameters.putString("fields", "id,email,first_name,last_name");
        request.setParameters(parameters);
        request.executeAsync();
    }
      protected void onActivityResult(int requestCode, int resultCode, Intent data) {
            callbackManager.onActivityResult(requestCode, resultCode, data);
    }

I know this is an old question but I did it like:

<asp:RadioButtonList runat="server" ID="myrbl" RepeatDirection="Horizontal" CssClass="rbl"> 

Use this as your class:

.rbl input[type="radio"]
{
   margin-left: 10px;
   margin-right: 1px;
}

Vanilla JS, without jQuery:

document.querySelector('#message span').innerHTML = 'hello world!'

Available in all browsers: https://caniuse.com/#search=querySelector

I think the best method :)

int angle = 0;
imageView.setOnClickListener(new View.OnClickListener() {
        @Override
        public void onClick(View v) {
            angle = angle + 90;
            imageView.setRotation(angle);
        }
    });

• If you want to simulate someone clicking on a link, use location.href.
• If you want to simulate an HTTP redirect, use location.replace.

For example:

// Similar behavior as an HTTP redirect
window.location.replace("http://stackoverflow.com");

// Similar behavior as clicking on a link
window.location.href = "http://stackoverflow.com";

_{Information copied from this answer to a duplicate question}

If you want to create a audio/video duration string like YouTube, etc. you can do:

($seconds >= 60) ? ltrim(gmdate("H:i:s", $seconds), ":0") : gmdate("0:s", $seconds)

Will return strings like:

55.55 => '0:55'
100   => '1:40'

Probably won't work well for time >= 24 hours.

The thing is that you are using the option -t when running your container.

Could you check if enabling the tty option (see reference) in your docker-compose.yml file the container keeps running?

version: '2'
services:
  ubuntu:
        build: .
        container_name: ubuntu
        volumes:
            - ~/sph/laravel52:/www/laravel
        ports:
          - "80:80"
        tty: true

If you are using Eclipse Neon, try this:

1) Add the maven plugin in the properties section of the POM:

<properties>
    <java.version>1.8</java.version>
    <maven-jar-plugin.version>3.1.1</maven-jar-plugin.version>
</properties>

2) Force update of project snapshot by right clicking on Project

Maven -> Update Project -> Select your Project -> Tick on the 'Force Update of Snapshots/Releases' option -> OK

You can select multiple classes at once with jQuery like this:

$('.tag, .tag2').click(function() {
    var $this = $(this);
    if ($this.hasClass('tag')) {
        // do stuff
    } else {
        // do other stuff
    }
});

Giving a 2nd parameter to the $() function, scopes the selector so $('.tag', '.tag2') looks for tag within elements with the class tag2.

Taken from the Android sources here. This is the actual code that shows your MAC ADDRESS in the system's settings app.

private void refreshWifiInfo() {
    WifiInfo wifiInfo = mWifiManager.getConnectionInfo();

    Preference wifiMacAddressPref = findPreference(KEY_MAC_ADDRESS);
    String macAddress = wifiInfo == null ? null : wifiInfo.getMacAddress();
    wifiMacAddressPref.setSummary(!TextUtils.isEmpty(macAddress) ? macAddress
            : getActivity().getString(R.string.status_unavailable));

    Preference wifiIpAddressPref = findPreference(KEY_CURRENT_IP_ADDRESS);
    String ipAddress = Utils.getWifiIpAddresses(getActivity());
    wifiIpAddressPref.setSummary(ipAddress == null ?
            getActivity().getString(R.string.status_unavailable) : ipAddress);
}

Well I found the solution. It can be done one by passing a closure function in with() as second index of array like

Post::query()
    ->with(array('user' => function($query) {
        $query->select('id','username');
    }))
    ->get();

It will only select id and username from other table. I hope this will help others.

Remember that the primary key (id in this case) needs to be the first param in the $query->select() to actually retrieve the necessary results.*

You need to install JMF first (download using this link)

File f = new File("D:/Songs/preview.mp3");
MediaLocator ml = new MediaLocator(f.toURL());
Player p = Manager.createPlayer(ml);
p.start();

don't forget to add JMF jar files

You can use OnClientClick event to call a JavaScript function:

<asp:Button ID="Button1" runat="server" Text="Button" onclientclick='redirect()' />

JavaScript code:

function redirect() {
  location.href = 'page.aspx';
}

But i think the best would be to style a hyperlink with css.

Example :

.button {
  display: block;
  height: 25px;
  background: #f1f1f1;
  padding: 10px;
  text-align: center;
  border-radius: 5px;
  border: 1px solid #e1e1e2;
  color: #000;
  font-weight: bold;
}

Numpy is required by pandas (and by virtually all numerical tools for Python). Scipy is not strictly required for pandas but is listed as an "optional dependency". I wouldn't say that pandas is an alternative to Numpy and/or Scipy. Rather, it's an extra tool that provides a more streamlined way of working with numerical and tabular data in Python. You can use pandas data structures but freely draw on Numpy and Scipy functions to manipulate them.

For me, the below helped

Find org.apache.http.legacy.jar which is in Android/Sdk/platforms/android-23/optional, add it to your dependency.

Source

For vue-cli 3 open package.json and under section eslintConfig put no-console under rules and restart dev server (npm run serve or yarn serve)

...
"eslintConfig": {
    ...
    "rules": {
      "no-console": "off"
    },
    ...

Just a benchmark:

BenchmarkDotNet=v0.12.1, OS=Windows 10.0.18363.997 (1909/November2018Update/19H2)
Intel Core i7-6700HQ CPU 2.60GHz (Skylake), 1 CPU, 8 logical and 4 physical cores
.NET Core SDK=3.1.302
  [Host]        : .NET Core 3.1.6 (CoreCLR 4.700.20.26901, CoreFX 4.700.20.31603), X64 RyuJIT
  .NET Core 3.1 : .NET Core 3.1.6 (CoreCLR 4.700.20.26901, CoreFX 4.700.20.31603), X64 RyuJIT

Job=.NET Core 3.1  Runtime=.NET Core 3.1

|           Method |     Mean |     Error |    StdDev |
|----------------- |---------:|----------:|----------:|
| EnumerableRepeat | 2.311 us | 0.0228 us | 0.0213 us |
|  NewArrayForEach | 2.007 us | 0.0392 us | 0.0348 us |
|        ArrayFill | 2.426 us | 0.0103 us | 0.0092 us |

    [SimpleJob(BenchmarkDotNet.Jobs.RuntimeMoniker.NetCoreApp31)]
    public class InitializeArrayBenchmark {
        const int ArrayLength = 1600;

        [Benchmark]
        public double[] EnumerableRepeat() {
            return Enumerable.Repeat(double.PositiveInfinity, ArrayLength).ToArray();
        }

        [Benchmark]
        public double[] NewArrayForEach() {
            var array = new double[ArrayLength];

            for (int i = 0; i < array.Length; i++) {
                array[i] = double.PositiveInfinity;
            }

            return array;
        }

        [Benchmark]
        public double[] ArrayFill() {
            var array = new double[ArrayLength];
            Array.Fill(array, double.PositiveInfinity);

            return array;
        }
    }

<html>
<head >
<title>Welcome</title>    
<style type="text/css">
#maincontainer 
{   
top:0px;
padding-top:0;
margin:auto; position:relative;
width:950px;
height:100%;
}
  </style>
  </head>
<body>
 <div id="maincontainer ">
 </div>
</body>
</html>

I needed to know the script name and where it is executing from.

Prefixing "$global:" to the MyInvocation structure returns the full path and script name when called from both the main script, and the main line of an imported .PSM1 library file. It also works from within a function in an imported library.

After much fiddling around, I settled on using $global:MyInvocation.InvocationName. It works reliably with CMD launch, Run With Powershell, and the ISE. Both local and UNC launches return the correct path.

You can just as easily access each element in the list using e.g. path[[1]]. You can't put a set of matrices into an atomic vector and access each element. A matrix is an atomic vector with dimension attributes. I would use the list structure returned by split, it's what it was designed for. Each list element can hold data of different types and sizes so it's very versatile and you can use *apply functions to further operate on each element in the list. Example below.

#  For reproducibile data
set.seed(1)

#  Make some data
userid <- rep(1:2,times=4)
data1 <- replicate(8 , paste( sample(letters , 3 ) , collapse = "" ) )
data2 <- sample(10,8)
df <- data.frame( userid , data1 , data2 )

#  Split on userid
out <- split( df , f = df$userid )
#$`1`
#  userid data1 data2
#1      1   gjn     3
#3      1   yqp     1
#5      1   rjs     6
#7      1   jtw     5

#$`2`
#  userid data1 data2
#2      2   xfv     4
#4      2   bfe    10
#6      2   mrx     2
#8      2   fqd     9

Access each element using the [[ operator like this:

out[[1]]
#  userid data1 data2
#1      1   gjn     3
#3      1   yqp     1
#5      1   rjs     6
#7      1   jtw     5

Or use an *apply function to do further operations on each list element. For instance, to take the mean of the data2 column you could use sapply like this:

sapply( out , function(x) mean( x$data2 ) )
#   1    2 
#3.75 6.25 

It's been a while since I posted this, but I thought I would show how I figured it out (as best as I recall now).

I did a Maven dependency tree to find dependency conflicts, and I removed all conflicts with exclusions in dependencies, e.g.:

<dependency>
    <groupId>commons-logging</groupId>
    <artifactId>commons-logging-api</artifactId>
    <version>1.1</version>
    <exclusions>
        <exclusion>
            <groupId>javax.servlet</groupId>
            <artifactId>servlet-api</artifactId>
        </exclusion>
    </exclusions>
</dependency>

Also, I used the provided scope for javax.servlet dependencies so as not to introduce an additional conflict with what is provided by Tomcat when I run the app.

<dependency>
    <groupId>javax.servlet</groupId>
    <artifactId>servlet-api</artifactId>
    <version>2.5</version>
    <scope>provided</scope>
</dependency>
<dependency>
    <groupId>javax.servlet.jsp</groupId>
    <artifactId>jsp-api</artifactId>
    <version>2.1</version>
    <scope>provided</scope>
</dependency>

HTH.

Try this:

$('#form').submit(function(eventObj) {
    $(this).append('<input type="hidden" name="field_name" value="value" /> ');
    return true;
});

File FileOne.js:

module.exports = { ClientIDUnsplash : 'SuperSecretKey' };

File FileTwo.js:

var { ClientIDUnsplash } = require('./FileOne');

This example works best for React.

You could try using the -Clear parameter

Example:-Clear Attribute1LDAPDisplayName, Attribute2LDAPDisplayName

http://technet.microsoft.com/en-us/library/ee617215.aspx

Well, I'm not sure if my solution is best practice. Using the NotificationBuilder my code looks like that:

private void showNotification() {
    Intent notificationIntent = new Intent(this, MainActivity.class);

    PendingIntent contentIntent = PendingIntent.getActivity(
                this, 0, notificationIntent, PendingIntent.FLAG_UPDATE_CURRENT);
    builder.setContentIntent(contentIntent);
    NotificationManager notificationManager =
            (NotificationManager) getSystemService(Context.NOTIFICATION_SERVICE);
    notificationManager.notify(NOTIFICATION_ID, builder.build());
    }

Manifest:

    <activity
        android:name=".MainActivity"
        android:launchMode="singleInstance"
    </activity>

and here the Service:

    <service
        android:name=".services.ProtectionService"
        android:launchMode="singleTask">
    </service>

I don't know if there really is a singleTask at Service but this works properly at my application...

This is what I did to integrate Identity with an existing database.

1. Create a sample MVC project with MVC template. This has all the code needed for Identity implementation - Startup.Auth.cs, IdentityConfig.cs, Account Controller code, Manage Controller, Models and related views.

2. Install the necessary nuget packages for Identity and OWIN. You will get an idea by seeing the references in the sample Project and the answer by @Sam

3. Copy all these code to your existing project. Please note don't forget to add the "DefaultConnection" connection string for Identity to map to your database. Please check the ApplicationDBContext class in IdentityModel.cs where you will find the reference to "DefaultConnection" connection string.

4. This is the SQL script I ran on my existing database to create necessary tables:

   USE ["YourDatabse"]
   GO
   /****** Object:  Table [dbo].[AspNetRoles]    Script Date: 16-Aug-15 6:52:25 PM ******/
   SET ANSI_NULLS ON
   GO
   SET QUOTED_IDENTIFIER ON
   GO
   CREATE TABLE [dbo].[AspNetRoles](
   [Id] [nvarchar](128) NOT NULL,
   [Name] [nvarchar](256) NOT NULL,
   CONSTRAINT [PK_dbo.AspNetRoles] PRIMARY KEY CLUSTERED 
   (
     [Id] ASC
   )WITH (PAD_INDEX = OFF, STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY]
   ) ON [PRIMARY]
   
   GO
   /****** Object:  Table [dbo].[AspNetUserClaims]    Script Date: 16-Aug-15 6:52:25 PM ******/
   SET ANSI_NULLS ON
   GO
   SET QUOTED_IDENTIFIER ON
   GO
   CREATE TABLE [dbo].[AspNetUserClaims](
      [Id] [int] IDENTITY(1,1) NOT NULL,
      [UserId] [nvarchar](128) NOT NULL,
      [ClaimType] [nvarchar](max) NULL,
      [ClaimValue] [nvarchar](max) NULL,
   CONSTRAINT [PK_dbo.AspNetUserClaims] PRIMARY KEY CLUSTERED 
   (
      [Id] ASC
   )WITH (PAD_INDEX = OFF, STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY]
   ) ON [PRIMARY] TEXTIMAGE_ON [PRIMARY]
   
   GO
   /****** Object:  Table [dbo].[AspNetUserLogins]    Script Date: 16-Aug-15 6:52:25 PM ******/
   SET ANSI_NULLS ON
   GO
   SET QUOTED_IDENTIFIER ON
   GO
   CREATE TABLE [dbo].[AspNetUserLogins](
       [LoginProvider] [nvarchar](128) NOT NULL,
       [ProviderKey] [nvarchar](128) NOT NULL,
       [UserId] [nvarchar](128) NOT NULL,
   CONSTRAINT [PK_dbo.AspNetUserLogins] PRIMARY KEY CLUSTERED 
   (
       [LoginProvider] ASC,
       [ProviderKey] ASC,
       [UserId] ASC
   )WITH (PAD_INDEX = OFF, STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY]
   ) ON [PRIMARY]
   
   GO
   /****** Object:  Table [dbo].[AspNetUserRoles]    Script Date: 16-Aug-15 6:52:25 PM ******/
   SET ANSI_NULLS ON
   GO
   SET QUOTED_IDENTIFIER ON
   GO
   CREATE TABLE [dbo].[AspNetUserRoles](
      [UserId] [nvarchar](128) NOT NULL,
      [RoleId] [nvarchar](128) NOT NULL,
   CONSTRAINT [PK_dbo.AspNetUserRoles] PRIMARY KEY CLUSTERED 
   (
       [UserId] ASC,
       [RoleId] ASC
   )WITH (PAD_INDEX = OFF, STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY]
   ) ON [PRIMARY]
   
   GO
   /****** Object:  Table [dbo].[AspNetUsers]    Script Date: 16-Aug-15 6:52:25 PM ******/
   SET ANSI_NULLS ON
   GO
   SET QUOTED_IDENTIFIER ON
   GO
   CREATE TABLE [dbo].[AspNetUsers](
       [Id] [nvarchar](128) NOT NULL,
       [Email] [nvarchar](256) NULL,
       [EmailConfirmed] [bit] NOT NULL,
       [PasswordHash] [nvarchar](max) NULL,
       [SecurityStamp] [nvarchar](max) NULL,
       [PhoneNumber] [nvarchar](max) NULL,
       [PhoneNumberConfirmed] [bit] NOT NULL,
       [TwoFactorEnabled] [bit] NOT NULL,
       [LockoutEndDateUtc] [datetime] NULL,
       [LockoutEnabled] [bit] NOT NULL,
       [AccessFailedCount] [int] NOT NULL,
       [UserName] [nvarchar](256) NOT NULL,
   CONSTRAINT [PK_dbo.AspNetUsers] PRIMARY KEY CLUSTERED 
   (
       [Id] ASC
   )WITH (PAD_INDEX = OFF, STATISTICS_NORECOMPUTE = OFF, IGNORE_DUP_KEY = OFF, ALLOW_ROW_LOCKS = ON, ALLOW_PAGE_LOCKS = ON) ON [PRIMARY]
   ) ON [PRIMARY] TEXTIMAGE_ON [PRIMARY]
   
    GO
    ALTER TABLE [dbo].[AspNetUserClaims]  WITH CHECK ADD  CONSTRAINT [FK_dbo.AspNetUserClaims_dbo.AspNetUsers_UserId] FOREIGN KEY([UserId])
    REFERENCES [dbo].[AspNetUsers] ([Id])
    ON DELETE CASCADE
    GO
    ALTER TABLE [dbo].[AspNetUserClaims] CHECK CONSTRAINT [FK_dbo.AspNetUserClaims_dbo.AspNetUsers_UserId]
    GO
    ALTER TABLE [dbo].[AspNetUserLogins]  WITH CHECK ADD  CONSTRAINT [FK_dbo.AspNetUserLogins_dbo.AspNetUsers_UserId] FOREIGN KEY([UserId])
    REFERENCES [dbo].[AspNetUsers] ([Id])
    ON DELETE CASCADE
    GO
    ALTER TABLE [dbo].[AspNetUserLogins] CHECK CONSTRAINT [FK_dbo.AspNetUserLogins_dbo.AspNetUsers_UserId]
    GO
    ALTER TABLE [dbo].[AspNetUserRoles]  WITH CHECK ADD  CONSTRAINT [FK_dbo.AspNetUserRoles_dbo.AspNetRoles_RoleId] FOREIGN KEY([RoleId])
    REFERENCES [dbo].[AspNetRoles] ([Id])
    ON DELETE CASCADE
    GO
    ALTER TABLE [dbo].[AspNetUserRoles] CHECK CONSTRAINT [FK_dbo.AspNetUserRoles_dbo.AspNetRoles_RoleId]
    GO
    ALTER TABLE [dbo].[AspNetUserRoles]  WITH CHECK ADD  CONSTRAINT [FK_dbo.AspNetUserRoles_dbo.AspNetUsers_UserId] FOREIGN KEY([UserId])
    REFERENCES [dbo].[AspNetUsers] ([Id])
    ON DELETE CASCADE
    GO
    ALTER TABLE [dbo].[AspNetUserRoles] CHECK CONSTRAINT [FK_dbo.AspNetUserRoles_dbo.AspNetUsers_UserId]
    GO
   

5. Check and solve any remaining errors and you are done. Identity will handle the rest :)

Just to update, following iOS 13, we now have SceneDelegates. So one might choose to put the desired tab selection in SceneDelegate.swift as follows:

class SceneDelegate: UIResponder, UIWindowSceneDelegate {

    var window: UIWindow?

    func scene(_ scene: UIScene, 
               willConnectTo session: UISceneSession, 
               options connectionOptions: UIScene.ConnectionOptions) {

        guard let _ = (scene as? UIWindowScene) else { return }

        if let tabBarController = self.window!.rootViewController as? UITabBarController {
            tabBarController.selectedIndex = 1
        }

    }

You can try using this way :

sentence ["Robert"] = "Roger"

Then the sentence will become :

sentence = "My name is Roger" # Robert is replaced with Roger

A little bit simpler and more effective variation of @yannis solution:

SELECT 
    title,
    description,    
    CHAR_LENGTH(description) - CHAR_LENGTH( REPLACE ( description, 'value', '1234') ) 
        AS `count`    
FROM <table> 

The difference is that I replace the "value" string with a 1-char shorter string ("1234" in this case). This way you don't need to divide and round to get an integer value.

Generalized version (works for every needle string):

SET @needle = 'value';
SELECT 
    description,    
    CHAR_LENGTH(description) - CHAR_LENGTH(REPLACE(description, @needle, SPACE(LENGTH(@needle)-1))) 
        AS `count`    
FROM <table> 

If this helps anyone, neither "python [filename].py" or "python.exe [filename.py]" worked for me, but "start python [filename].py" did. If anyone else is experiencing issues with the former two commands, try the latter one.

This should give you a list of all the tables in your database

SELECT Distinct TABLE_NAME FROM information_schema.TABLES

So you can use it similar to your database check.

If NOT EXISTS(SELECT Distinct TABLE_NAME FROM information_schema.TABLES Where TABLE_NAME = 'Your_Table')
BEGIN
    --CREATE TABLE Your_Table
END
GO

In my case, I had installed it in the virtualenv but forgot to activate the virtualenv while running the command

 python3 manage.py makemigrations 

So in my case I had to just activate the environment and then run the command

source [virtualenv folder-name]/bin/activate
python3 manage.py makemigrations

This solved my problem.

In percentage :

$('.your-class').click(function (e){
    var $this = $(this); // or use $(e.target) in some cases;
    var offset = $this.offset();
    var width = $this.width();
    var height = $this.height();
    var posX = offset.left;
    var posY = offset.top;
    var x = e.pageX-posX;
        x = parseInt(x/width*100,10);
        x = x<0?0:x;
        x = x>100?100:x;
    var y = e.pageY-posY;
        y = parseInt(y/height*100,10);
        y = y<0?0:y;
        y = y>100?100:y;
    console.log(x+'% '+y+'%');
});

Quoting https://web.archive.org/web/20140227201242/http://v1.dione.zcu.cz/java/docs/jndi-1.2/tutorial/beyond/misc/policy.html

At the root context of the namespace is a binding with the name "comp", which is bound to a subtree reserved for component-related bindings. The name "comp" is short for component. There are no other bindings at the root context. However, the root context is reserved for the future expansion of the policy, specifically for naming resources that are tied not to the component itself but to other types of entities such as users or departments. For example, future policies might allow you to name users and organizations/departments by using names such as "java:user/alice" and "java:org/engineering".

In the "comp" context, there are two bindings: "env" and "UserTransaction". The name "env" is bound to a subtree that is reserved for the component's environment-related bindings, as defined by its deployment descriptor. "env" is short for environment. The J2EE recommends (but does not require) the following structure for the "env" namespace.

So the binding you did from spring or, for example, from a tomcat context descriptor go by default under java:comp/env/

For example, if your configuration is:

<bean id="someId" class="org.springframework.jndi.JndiObjectFactoryBean">
  <property name="jndiName" value="foo"/>
</bean>

Then you can access it directly using:

Context ctx = new InitialContext();
DataSource ds = (DataSource)ctx.lookup("java:comp/env/foo");

or you could make an intermediate step so you don't have to specify "java:comp/env" for every resource you retrieve:

Context ctx = new InitialContext();
Context envCtx = (Context)ctx.lookup("java:comp/env");
DataSource ds = (DataSource)envCtx.lookup("foo");

It does work by just taking the argument 'rb' read binary instead of 'r' read

You could also have a look at the DataContractJsonSerializer

I wonder whether the below method is what you want.

You can use defaultdict.

>>> from collections import defaultdict
>>> s = [('red',1), ('blue',2), ('red',3), ('blue',4), ('red',1), ('blue',4)]
>>> d = defaultdict(list)
>>> for k, v in s:
       d[k].append(v)    
>>> sorted(d.items())
[('blue', [2, 4, 4]), ('red', [1, 3, 1])]

NSArray and NSMutableArray provide methods to filter array contents. NSArray provides filteredArrayUsingPredicate: which returns a new array containing objects in the receiver that match the specified predicate. NSMutableArray adds filterUsingPredicate: which evaluates the receiver’s content against the specified predicate and leaves only objects that match. These methods are illustrated in the following example.

NSMutableArray *array =
    [NSMutableArray arrayWithObjects:@"Bill", @"Ben", @"Chris", @"Melissa", nil];

NSPredicate *bPredicate =
    [NSPredicate predicateWithFormat:@"SELF beginswith[c] 'b'"];
NSArray *beginWithB =
    [array filteredArrayUsingPredicate:bPredicate];
// beginWithB contains { @"Bill", @"Ben" }.

NSPredicate *sPredicate =
    [NSPredicate predicateWithFormat:@"SELF contains[c] 's'"];
[array filteredArrayUsingPredicate:sPredicate];
// array now contains { @"Chris", @"Melissa" }

You have to first Install JDK in your system.

Set Java Home

JAVA_HOME = C:\Program Files\Java\jdk1.7.0 [Location of your JDK Installation Directory]

Once you have the JDK installation path:

• Right-click the My Computer icon on
• Select Properties.
• Click the Advanced system setting tab on left side of your screen
• Aadvance Popup is open.
• Click on Environment Variables button.

• Under System Variables, click New.
• Enter the variable name as JAVA_HOME.
• Enter the variable value as the installation path for the Java Development Kit.
• Click OK.
• Click Apply Changes.

Set JAVA Path under system variable

PATH= C:\Program Files\Java\jdk1.7.0; [Append Value with semi-colon]

private function getStringBetween(string $from, string $to, string $haystack): string
{
    $fromPosition = strpos($haystack, $from);
    $toPosition = strpos($haystack, $to, $fromPosition);
    $betweenLength = $toPosition - $fromPosition;
    return substr($haystack, $fromPosition, $betweenLength);
}

If you are going to be adding lots of items, consider deriving your own class from ObservableCollection and adding items to the protected Items member - this won't raise events in observers. When you are done you can raise the appropriate events:

public class BulkUpdateObservableCollection<T> : ObservableCollection<T>
{
    public void AddRange(IEnumerable<T> collection)
    {
        foreach (var i in collection) Items.Add(i);
        OnCollectionChanged(new NotifyCollectionChangedEventArgs(NotifyCollectionChangedAction.Reset));
        OnPropertyChanged(new PropertyChangedEventArgs("Count"));
    }
 }

When adding many items to an ObservableCollection that is already bound to a UI element (such as LongListSelector) this can make a massive performance difference.

Prior to adding the items, you could also ensure you have enough space, so that the list isn't continually being expanded by implementing this method in the BulkObservableCollection class and calling it prior to calling AddRange:

    public void IncreaseCapacity(int increment)
    {
        var itemsList = (List<T>)Items;
        var total = itemsList.Count + increment;
        if (itemsList.Capacity < total)
        {
            itemsList.Capacity = total;
        }
    }

Here is another cool way to do it- using en external viewer that accepts command line switches (IrfanView in this case) : * I based the loop on what Michal Krzych has written above.

Sub ExportPicturesToFiles()
    Const saveSceenshotTo As String = "C:\temp\"
    Const pictureFormat As String = ".jpg"

    Dim pic As Shape
    Dim sFileName As String
    Dim i As Long

    i = 1

    For Each pic In ActiveSheet.Shapes
        pic.Copy
        sFileName = saveSceenshotTo & Range("A" & i).Text & pictureFormat

        Call ExportPicWithIfran(sFileName)

        i = i + 1
    Next
End Sub

Public Sub ExportPicWithIfran(sSaveAsPath As String)
    Const sIfranPath As String = "C:\Program Files\IrfanView\i_view32.exe"
    Dim sRunIfran As String

    sRunIfran = sIfranPath & " /clippaste /convert=" & _
                            sSaveAsPath & " /killmesoftly"

    ' Shell is no good here. If you have more than 1 pic, it will
    ' mess things up (pics will over run other pics, becuase Shell does
    ' not make vba wait for the script to finish).
    ' Shell sRunIfran, vbHide

    ' Correct way (it will now wait for the batch to finish):
    call MyShell(sRunIfran )
End Sub

Edit:

  Private Sub MyShell(strShell As String)
  ' based on:
    ' http://stackoverflow.com/questions/15951837/excel-vba-wait-for-shell-command-to-complete
   ' by Nate Hekman

    Dim wsh As Object
    Dim waitOnReturn As Boolean:
    Dim windowStyle As VbAppWinStyle

    Set wsh = VBA.CreateObject("WScript.Shell")
    waitOnReturn = True
    windowStyle = vbHide

    wsh.Run strShell, windowStyle, waitOnReturn
End Sub

or try NSString *string = [NSString stringWithFormat:@"%d", [NSNumber intValue], nil];

Python comes with several built-in decorators. The big three are:

@classmethod
@staticmethod
@property

@classmethod decorator can be called with with an instance of a class or directly by the class itself as its first argument.

@staticmethod is a way of putting a function into a class (because it logically belongs there), while indicating that it does not require access to the class.

Let's consider the following class:

class DecoratorTest(object):

    def __init__(self):
        pass

    def doubler(self, x):
        print("running doubler")
        return x*2

    @classmethod
    def class_doubler(klass, x):
        print("running doubler: %s" % klass)
        return x*2

    @staticmethod
    def static_doubler(x):
        print("running quad")
        return x*2

decor = DecoratorTest()

Let's see how it works:

print(decor.doubler(5))
# running doubler
# 10

print(decor.class_doubler(5))
# running doubler: <class '__main__.DecoratorTest'> 
# 10
print(DecoratorTest.class_doubler(5))
# running doubler: <class '__main__.DecoratorTest'> 
# 10

print(DecoratorTest.static_doubler(5))
# running doubler 
# 10
print(decor.static_doubler(5))
# running doubler 
# 10

print(decor.doubler)
# <bound method DecoratorTest.doubler of <__main__.DecoratorTest object at 0x7f90e74fd150>> 
print(decor.class_doubler)
# <bound method DecoratorTest.class_doubler of <class '__main__.DecoratorTest'>> 
print(decor.static_doubler)
# <function DecoratorTest.static_doubler at 0x7f90e7447440> 

Check label text height and it is working on it

let labelTextSize = ((labelDescription.text)! as NSString).boundingRect(
                with: CGSize(width: labelDescription.frame.width, height: .greatestFiniteMagnitude),
                options: .usesLineFragmentOrigin,
                attributes: [.font: labelDescription.font],
                context: nil).size
            if labelTextSize.height > labelDescription.bounds.height {
                viewMoreOrLess.hide(byHeight: false)
                viewLess.hide(byHeight: false)
            }
            else {
                viewMoreOrLess.hide(byHeight: true)
                viewLess.hide(byHeight: true)

            }

char *p = "String";   means pointer to a string type variable.

char p3[5] = "String"; means you are pre-defining the size of the array to consist of no more than 5 elements. Note that,for strings the null "\0" is also considered as an element.So,this statement would give an error since the number of elements is 7 so it should be:

char p3[7]= "String";

Ended up using eclipse.ini fix:

openFile
-vm (Your Java Home JDK here)

For example, -vm C:\Java\JDK\1.6.

Had to also change JRE to JDK:

In Eclipse IDE go to:

1. Window -> Preferences -> Installed JREs
2. Click on Add (to locate new JRE)
3. Select standard JVM -> next
4. Click on Directory to locate JRE home, put JDK_INSTALL_LOCATION and finish.
5. Go to your java project's Properties -> Java build Path -> Libraries -> select JRE -> Edit -> select Workspace default JRE -> finish
6. Do a full workspace cleanup with project -> clean.

If you want to get information about your installed python distributions and don't want to use your cmd console or terminal for it, but rather through python code, you can use the following code (tested with python 3.4):

import pip #needed to use the pip functions
for i in pip.get_installed_distributions(local_only=True):
    print(i)

The pip.get_installed_distributions(local_only=True) function-call returns an iterable and because of the for-loop and the print function the elements contained in the iterable are printed out separated by new line characters (\n). The result will (depending on your installed distributions) look something like this:

cycler 0.9.0
decorator 4.0.4
ipykernel 4.1.0
ipython 4.0.0
ipython-genutils 0.1.0
ipywidgets 4.0.3
Jinja2 2.8
jsonschema 2.5.1
jupyter 1.0.0
jupyter-client 4.1.1
#... and so on...

The same error is produced in MariaDB (10.1.36-MariaDB) by using the combination of parenthesis and the COLLATE statement. My SQL was different, the error was the same, I had:

SELECT *
FROM table1
WHERE (field = 'STRING') COLLATE utf8_bin;

Omitting the parenthesis was solving it for me.

SELECT *
FROM table1
WHERE field = 'STRING' COLLATE utf8_bin;

Another example based off the original source, with a sample tree structure already in place (easier to see how it works IMO) and a filter to search the tree:

JSFiddle

In my Controller, I merely added an HttpServletResponse parameter and manually added the headers, no filter or intercept required and it works fine:

httpServletResponse.setHeader("Access-Control-Allow-Origin", "*");
httpServletResponse.setHeader("Access-Control-Allow-Methods", "GET, OPTIONS");
httpServletResponse.setHeader("Access-Control-Allow-Headers","Origin, X-Requested-With, Content-Type, Accept, X-Auth-Token, X-Csrf-Token, WWW-Authenticate, Authorization");
httpServletResponse.setHeader("Access-Control-Allow-Credentials", "false");
httpServletResponse.setHeader("Access-Control-Max-Age", "3600");

Maybe it's not exactly what you want to do, but using the ajax complete solved my problem of hiding a spinner when the ajax call returned.

So it would look something like this

var table = $('#example').DataTable( {
    "ajax": {
            "type" : "GET",
            "url" : "ajax.php",
            "dataSrc": "",
            "success": function () {
                alert("Done!");
            }       
    },
    "columns": [
            { "data": "name" },
            { "data": "position" },
            { "data": "office" },
            { "data": "extn" },
            { "data": "start_date" },
            { "data": "salary" }            
        ]
    } );

Suppose you have a data frame(say df) with columns "x" and "y", you can find mean of column (x or y) using:

1.Using mean() function

z<-mean(df$x)

2.Using the column name(say x) as a variable using attach() function

 attach(df)
 mean(x)

When done you can call detach() to remove "x"

detach()

3.Using with() function, it lets you use columns of data frame as distinct variables.

 z<-with(df,mean(x))

You could use:

System.Media.SoundPlayer player = new System.Media.SoundPlayer(@"c:\mywavfile.wav");
player.Play();

This line:

if(str2==${str}){

Should be:

if( str2 == str ) {

The ${ and } will give you a parse error, as they should only be used inside Groovy Strings for templating

You are missing spring-security-web-3.1.X.RELEASE.jar from your classpath

Here's some code that'll substitute for the blink tag

<p id="blink">This text will blink!</p>
<script>
var blacktime = 1000;
var whitetime = 1000;
//These can be as long as you desire in milliseconds
setTimeout(whiteFunc,blacktime);
function whiteFunc(){
    document.getElementById("blink").style.color = "white";
    setTimeout(blackFunc,whitetime);
}
function blackFunc(){
    document.getElementById("blink").style.color = "black";
    setTimeout(whiteFunc,blacktime);
}
</script>

DateTime.ParseExact(input,"yyyyMMdd HH:mm",null);

assuming you meant to say that minutes followed the hours, not seconds - your example is a little confusing.

The ParseExact documentation details other overloads, in case you want to have the parse automatically convert to Universal Time or something like that.

As @Joel Coehoorn mentions, there's also the option of using TryParseExact, which will return a Boolean value indicating success or failure of the operation - I'm still on .Net 1.1, so I often forget this one.

If you need to parse other formats, you can check out the Standard DateTime Format Strings.

("#tblEntAttributes tbody")

needs to be

$("#tblEntAttributes tbody").

You are not selecting the element with the correct syntax

Here's an example of both

$(newRowContent).appendTo($("#tblEntAttributes"));

and

$("#tblEntAttributes tbody").append(newRowContent);

working http://jsfiddle.net/xW4NZ/

To update an entity with Entity Framework Core, this is the logical process:

1. Create instance for DbContext class
2. Retrieve entity by key
3. Make changes on entity's properties
4. Save changes

Update() method in DbContext:

Begins tracking the given entity in the Modified state such that it will be updated in the database when SaveChanges() is called.

Update method doesn't save changes in database; instead, it sets states for entries in DbContext instance.

So, We can invoke Update() method before to save changes in database.

I'll assume some object definitions to answer your question:

1. Database name is Store

2. Table name is Product

Product class definition:

public class Product
{
    public int? ProductID { get; set; }
    
    public string ProductName { get; set; }
    
    public string Description { get; set; }
    
    public decimal? UnitPrice { get; set; }
}

DbContext class definition:

public class StoreDbContext : DbContext
{
    public DbSet<Product> Products { get; set; }
    
    protected override void OnConfiguring(DbContextOptionsBuilder optionsBuilder)
    {
        optionsBuilder.UseSqlServer("Your Connection String");

        base.OnConfiguring(optionsBuilder);
    }
    
    protected override void OnModelCreating(ModelBuilder modelBuilder)
    {
        modelBuilder.Entity<Order>(entity =>
        {
            // Set key for entity
            entity.HasKey(p => p.ProductID);
        });
        
        base.OnModelCreating(modelBuilder);
    }
}

Logic to update entity:

using (var context = new StoreDbContext())
{
        // Retrieve entity by id
        // Answer for question #1
        var entity = context.Products.FirstOrDefault(item => item.ProductID == id);
        
        // Validate entity is not null
        if (entity != null)
        {
            // Answer for question #2

            // Make changes on entity
            entity.UnitPrice = 49.99m;
            entity.Description = "Collector's edition";
            
            /* If the entry is being tracked, then invoking update API is not needed. 
              The API only needs to be invoked if the entry was not tracked. 
              https://www.learnentityframeworkcore.com/dbcontext/modifying-data */
            // context.Products.Update(entity);
            
            // Save changes in database
            context.SaveChanges();
        }
}

You can also do something:

SELECT CAST(CAST(34512367.392 AS decimal(30,9)) AS NVARCHAR(100))

Output: 34512367.392000000

I was able to use nginx to handle the 301 redirect to the aws signin page.

Go to your nginx conf folder (in my case it's /etc/nginx/sites-available in which I create a symlink to /etc/nginx/sites-enabled for the enabled conf files).

Then add a redirect path

server {
  listen 80;
  server_name aws.example.com;
  return 301 https://myaccount.signin.aws.amazon.com/console;
}

If you are using nginx, you will most likely have additional server blocks (virtualhosts in apache terminology) to handle your zone apex (example.com) or however you have it setup. Make sure that you have one of them set to be your default server.

server {
  listen 80 default_server;
  server_name example.com;
  # rest of config ...
}

In Route 53, add an A record for aws.example.com and set the value to the same IP used for your zone apex.

How about add this to your xaml:

<Separator/>

$('.modal').on('shown.bs.modal',function(){      //correct here use 'shown.bs.modal' event which comes in bootstrap3
  $(this).find('iframe').attr('src','http://www.google.com')
})

As shown above use 'shown.bs.modal' event which comes in bootstrap 3.

EDIT :-

and just try to open some other url from iframe other than google.com ,it will not allow you to open google.com due to some security threats.

The reason for this is, that Google is sending an "X-Frame-Options: SAMEORIGIN" response header. This option prevents the browser from displaying iFrames that are not hosted on the same domain as the parent page.

Give 0777 to all files and directories starting from the current path :

chmod -R 0777 ./

Other answers have covered pretty much everything about how we can pass model to our layout page. But I have found a way using which you can pass variables to your layout page dynamically without using any model or partial view in your layout. Let us say you have this model -

public class SubLocationsViewModel
{
    public string city { get; set; }
    public string state { get; set; }
}

And you want to get city and state dynamically. For e.g

in your index.cshtml you can put these two variables in ViewBag

@model  MyProject.Models.ViewModel.SubLocationsViewModel
@{
    ViewBag.City = Model.city;
    ViewBag.State = Model.state;
}

And then in your layout.cshtml you can access those viewbag variables

<div class="text-wrap">
    <div class="heading">@ViewBag.City @ViewBag.State</div>
</div>

You can learn some tutorials for JSP page direct access database (mysql) here

Notes:

• import sql tag library in jsp page

  <%@ taglib uri="http://java.sun.com/jsp/jstl/sql" prefix="sql"%>

• then set datasource on page

  <sql:setDataSource var="ds" driver="com.mysql.jdbc.Driver" url="jdbc:mysql://<yourhost>/<yourdb>" user="<user>" password="<password>"/>
  

• Now query what you want on page

  <sql:query dataSource="${ds}" var="result"> //ref  defined 'ds'
      SELECT * from <your-table>;
  </sql:query>
  

• Finally you can populate dropdowns on page using c:forEach tag to iterate result rows in select element

  <c:forEach var="row" items="${result.rows}"> //ref set var 'result' <option value='<c:out value="${row.key}"/>'><c:out value="${row.value}"/</option> </c:forEach>

Side note – if you want to use separate functions to set & clear interval, the interval variable have to be accessible for all of them, in 'relative global', or 'one level up' scope:

var interval = null;    

function startStuff(func, time) {
    interval = setInterval(func, time);
}

function stopStuff() {
    clearInterval(interval);
}

You're tired and cant do any more work. You eat food. The energy spent looking for food, getting it and actually eating it consumes energy and is overhead!

Overhead is something wasted in order to accomplish a task. The goal is to make overhead very very small.

In computer science lets say you want to print a number, thats your task. But storing the number, the setting up the display to print it and calling routines to print it, then accessing the number from variable are all overhead.

On Linux it's Monospace 10 pt. (the exact monospace font used may vary on different Linux distributions or versions), on Windows it's Consolas 10 pt., and on OS X it's Menlo Regular 12 pt.

^{(The color scheme is Neon, the syntax highlighting is from PackageDev, and the font is Liberation Mono}

This information is found in the Packages/Default directory (where Packages is the directory opened by the Preferences ? Browse Packages... menu option), in the Preferences (OS).sublime-settings file where OS is one of Windows, Linux, or OSX.

You should only customize the font (or any other setting) in Packages/User/Preferences.sublime-settings, opened by Preferences ? Settings—User, as Settings—Default is over-written on upgrade, and also serves as a backup in case you really screw something up in your user settings. This is the case for both the main Sublime settings as well as those for extra packages/plugins.

These default fonts are the same in Sublime Text 2, Sublime Text 3, and the new version currently in development.

There is still another way to do it, which is using a particular NamingStrategy, which can be applied to a class or a property by decorating them with [JSonObject] or [JsonProperty].

There are predefined naming strategies like CamelCaseNamingStrategy, but you can implement your own ones.

The implementation of different naming strategies can be found here: https://github.com/JamesNK/Newtonsoft.Json/tree/master/Src/Newtonsoft.Json/Serialization

{{ $post->created_at }}

will return '2014-06-26 04:07:31'

The solution is

{{ $post->created_at->format('Y-m-d') }}

Great answers. I also had a problem with NULLS and managed to solve it by including a COALESCE inside of the GROUP_CONCAT. Example as follows:

SELECT id, GROUP_CONCAT(COALESCE(name,'') SEPARATOR ' ') 
FROM table 
GROUP BY id;

Hope this helps someone else

Had the same problem....managed to get it to work after a little while.

Thing to do is follow instructions on installing FFmpeg - which is (at least on windows) a bundle of executables you need to set a path to in your environment variables

http://www.wikihow.com/Install-FFmpeg-on-Windows

Download from ffmpeg.org

Hope this helps someone - even after a while after the question - good luck

This formula seems more intuitive to me:

=SUBSTITUTE(A1,"SomeText","") <> A1

this returns TRUE if "SomeText" is contained within A1.

The IsNumber/Search and IsError/Find formulas mentioned in the other answers certainly do work, but I always find myself needing to look at the help or experimenting in Excel too often with those ones.

If d is a dictionary, then d.get(k, v) means, give me the value of k in d, unless k isn't there, in which case give me v. It's being used here to get the current count of the character, which should start at 0 if the character hasn't been encountered before.

tmp = df.groupby(['A'])['c'].transform('mean')

is like

tmp1 = df.groupby(['A']).agg({'c':'mean'})
tmp = df['A'].map(tmp1['c'])

or

tmp1 = df.groupby(['A'])['c'].mean()
tmp = df['A'].map(tmp1)

After reading through different methods suggested in the above answers, I decided to handle the authentication exceptions by using a custom filter. I was able to handle the response status and codes using an error response class using the following method.

I created a custom filter and modified my security config by using the addFilterAfter method and added after the CorsFilter class.

@Component
public class AuthFilter implements Filter {
@Override
public void doFilter(ServletRequest request, ServletResponse response, FilterChain chain) throws IOException, ServletException {
    //Cast the servlet request and response to HttpServletRequest and HttpServletResponse
    HttpServletResponse httpServletResponse = (HttpServletResponse) response;
    HttpServletRequest httpServletRequest = (HttpServletRequest) request;

    // Grab the exception from the request attribute
    Exception exception = (Exception) request.getAttribute("javax.servlet.error.exception");
    //Set response content type to application/json
    httpServletResponse.setContentType(MediaType.APPLICATION_JSON_VALUE);

    //check if exception is not null and determine the instance of the exception to further manipulate the status codes and messages of your exception
    if(exception!=null && exception instanceof AuthorizationParameterNotFoundException){
        ErrorResponse errorResponse = new ErrorResponse(exception.getMessage(),"Authetication Failed!");
        httpServletResponse.setStatus(HttpServletResponse.SC_UNAUTHORIZED);
        PrintWriter writer = httpServletResponse.getWriter();
        writer.write(convertObjectToJson(errorResponse));
        writer.flush();
        return;
    }
    // If exception instance cannot be determined, then throw a nice exception and desired response code.
    else if(exception!=null){
            ErrorResponse errorResponse = new ErrorResponse(exception.getMessage(),"Authetication Failed!");
            PrintWriter writer = httpServletResponse.getWriter();
            writer.write(convertObjectToJson(errorResponse));
            writer.flush();
            return;
        }
        else {
        // proceed with the initial request if no exception is thrown.
            chain.doFilter(httpServletRequest,httpServletResponse);
        }
    }

public String convertObjectToJson(Object object) throws JsonProcessingException {
    if (object == null) {
        return null;
    }
    ObjectMapper mapper = new ObjectMapper();
    return mapper.writeValueAsString(object);
}
}

SecurityConfig class

    @Configuration
    public class JwtSecurityConfig extends WebSecurityConfigurerAdapter {
    @Autowired
    AuthFilter authenticationFilter;
    @Override
    protected void configure(HttpSecurity http) throws Exception {
        http.addFilterAfter(authenticationFilter, CorsFilter.class).csrf().disable()
                .cors(); //........
        return http;
     }
   }

ErrorResponse class

public class ErrorResponse  {
private final String message;
private final String description;

public ErrorResponse(String description, String message) {
    this.message = message;
    this.description = description;
}

public String getMessage() {
    return message;
}

public String getDescription() {
    return description;
}}

As suggested, you can use getchar() to read from the console until an end-of-line or an EOF is returned, building your own buffer. Growing buffer dynamically can occur if you are unable to set a reasonable maximum line size.

You can use also use fgets as a safe way to obtain a line as a C null-terminated string:

#include <stdio.h>

char line[1024];  /* Generously large value for most situations */

char *eof;

line[0] = '\0'; /* Ensure empty line if no input delivered */
line[sizeof(line)-1] = ~'\0';  /* Ensure no false-null at end of buffer */

eof = fgets(line, sizeof(line), stdin);

If you have exhausted the console input or if the operation failed for some reason, eof == NULL is returned and the line buffer might be unchanged (which is why setting the first char to '\0' is handy).

fgets will not overfill line[] and it will ensure that there is a null after the last-accepted character on a successful return.

If end-of-line was reached, the character preceding the terminating '\0' will be a '\n'.

If there is no terminating '\n' before the ending '\0' it may be that there is more data or that the next request will report end-of-file. You'll have to do another fgets to determine which is which. (In this regard, looping with getchar() is easier.)

In the (updated) example code above, if line[sizeof(line)-1] == '\0' after successful fgets, you know that the buffer was filled completely. If that position is proceeded by a '\n' you know you were lucky. Otherwise, there is either more data or an end-of-file up ahead in stdin. (When the buffer is not filled completely, you could still be at an end-of-file and there also might not be a '\n' at the end of the current line. Since you have to scan the string to find and/or eliminate any '\n' before the end of the string (the first '\0' in the buffer), I am inclined to prefer using getchar() in the first place.)

Do what you need to do to deal with there still being more line than the amount you read as the first chunk. The examples of dynamically-growing a buffer can be made to work with either getchar or fgets. There are some tricky edge cases to watch out for (like remembering to have the next input start storing at the position of the '\0' that ended the previous input before the buffer was extended).

I've colour coded this figure to ease the process.

import matplotlib.pyplot as plt
fig = plt.figure()
ax = fig.add_subplot(111)

You can have full control over the figure using these commands, to complete the answer I've add also the control over the splines:

ax.spines['top'].set_visible(False)
ax.spines['right'].set_visible(False)

# X AXIS -BORDER
ax.spines['bottom'].set_visible(False)
# BLUE
ax.set_xticklabels([])
# RED
ax.set_xticks([])
# RED AND BLUE TOGETHER
ax.axes.get_xaxis().set_visible(False)

# Y AXIS -BORDER
ax.spines['left'].set_visible(False)
# YELLOW
ax.set_yticklabels([])
# GREEN
ax.set_yticks([])
# YELLOW AND GREEN TOGHETHER
ax.axes.get_yaxis().set_visible(False)

open sqlnet.ora  

NAMES.DIRECTORY_PATH= (TNSNAMES, EZCONNECT)
SQLNET.INBOUND_CONNECT_TIMEOUT=360
SQLNET.RECV_TIMEOUT=10
SQLNET.SEND_TIMEOUT=10

http://docs.oracle.com/cd/B19306_01/network.102/b14213/sqlnet.htm

This is a comprehensive answer to this question. I have done this because this page is high on the Google search results and the answer does not go into enough detail. This post assumes that you are competent at using Visual Studio C# forms. This is based on VS2012.

1. Start by simply dragging a ContextMenuStrip onto the form. It will just put it into the top left corner where you can add your menu items and rename it as you see fit.

2. You will have to view code and enter in an event yourself on the form. Create a mouse down event for the item in question and then assign a right click event for it like so (I have called the ContextMenuStrip "rightClickMenuStrip"):

   private void pictureBox1_MouseDown(object sender, MouseEventArgs e)
   {
   switch (e.Button)
       {
           case MouseButtons.Right:
           {
               rightClickMenuStrip.Show(this, new Point(e.X, e.Y));//places the menu at the pointer position
           }
           break;
       }
   }
   

3. Assign the event handler manually to the form.designer (you may need to add a "using" for System.Windows.Forms; You can just resolve it):

   this.pictureBox1.MouseDown += new MouseEventHandler(this.pictureBox1_MouseDown);
   

4. All that is needed at this point is to simply double click each menu item and do the desired operations for each click event in the same way you would for any other button.

This is the basic code for this operation. You can obviously modify it to fit in with your coding practices.

When one gets the error 'sub-query returns more than 1 row', the database is actually telling you that there is an unresolvable circular reference. It's a bit like using a spreadsheet and saying cell A1 = B1 and then saying B1 = A1. This error is typically associated with a scenario where one needs to have a double nested sub-query. I would recommend you look up a thing called a 'cross-tab query' this is the type of query one normally needs to solve this problem. It's basically an outer join (left or right) nested inside a sub-query or visa versa. One can also solve this problem with a double join (also considered to be a type of cross-tab query) such as below:

CREATE DEFINER=`root`@`localhost` PROCEDURE `SP_GET_VEHICLES_IN`(
    IN P_email VARCHAR(150),
    IN P_credentials VARCHAR(150)
)
BEGIN
    DECLARE V_user_id INT(11);
    SET V_user_id = (SELECT user_id FROM users WHERE email = P_email AND credentials = P_credentials LIMIT 1);
    SELECT vehicles_in.vehicle_id, vehicles_in.make_id, vehicles_in.model_id, vehicles_in.model_year,
    vehicles_in.registration, vehicles_in.date_taken, make.make_label, model.model_label
    FROM make
    LEFT OUTER JOIN vehicles_in ON vehicles_in.make_id = make.make_id
    LEFT OUTER JOIN model ON model.make_id = make.make_id AND vehicles_in.model_id = model.model_id
    WHERE vehicles_in.user_id = V_user_id;
END

In the code above notice that there are three tables in amongst the SELECT clause and these three tables show up after the FROM clause and after the two LEFT OUTER JOIN clauses, these three tables must be distinct amongst the FROM and LEFT OUTER JOIN clauses to be syntactically correct.

It is noteworthy that this is a very important construct to know as a developer especially if you're writing periodical report queries and it's probably the most important skill for any complex cross referencing, so all developers should study these constructs (cross-tab and double join).

Another thing I must warn about is: If you are going to use a cross-tab as a part of a working system and not just a periodical report, you must check the record count and reconfigure the join conditions until the minimum records are returned, otherwise large tables and cross-tabs can grind your server to a halt. Hope this helps.

The correct one for me is the Zuan solution. Be aware to add isset to $args->add_li_class , however you got Notice: Undefined property: stdClass::$add_li_class if you haven't set the property in all yours wp_nav_menu() functions.

This is the function that worked for me:

function add_additional_class_on_li($classes, $item, $args) {
    if(isset($args->add_li_class)) {
      $classes[] = $args->add_li_class;
    }
    return $classes;
}
add_filter('nav_menu_css_class', 'add_additional_class_on_li', 1, 3);

sed 's/^/.+/' infile | bc | tail -1

I have created a simple program for this and your question helped me complete the solution... I added one more feature and few configurations. In case you want to add a specific character/ string after every few lines (configurable). Please go through the notes. I have added the code files : https://github.com/mohitsharma779/FileSplit

I ran into the same issue and found that it was my IDE was part of the issue. I was launching the debugger directly from the IDE (PHPStorm) instead of just using the browser directly. The IDE spawned URL was like this:

"...localhost:63342/CB_Upload/index.php?_ijt=j2hcbacqepj87bvg66ncuohvne"

and just using:

"...localhost/CB_Upload/index.php"

worked just fine. My set up is PC / Windows 10 / WAMPSERVER 3.0.6 64bit

You'll have to pass the new ordinal position to insert using len in this case:

In [62]:

a=[1,2,3,4]
a.insert(len(a),5)
a
Out[62]:
[1, 2, 3, 4, 5]

The object, method, and property names in the .NET language bindings do not exactly correspond to those in the Java bindings. One of the principles of the project is that each language binding should "feel natural" to those comfortable coding in that language. In C#, the code you'd want for executing JavaScript is as follows

IWebDriver driver; // assume assigned elsewhere
IJavaScriptExecutor js = (IJavaScriptExecutor)driver;
string title = (string)js.ExecuteScript("return document.title");

Note that the complete documentation of the WebDriver API for .NET can be found at this link.

There are two issues here:

Disabling the button on the client side prevents the postback

To overcome this, disable the button after the JavaScript onclick event. An easy way to do this is to use setTimeout as suggested by this answer.

Also, the OnClientClick code runs even if ASP.NET validation fails, so it's probably a good idea to add a check for Page_IsValid. This ensures that the button will not be disabled if validation fails.

OnClientClick="(function(button) { setTimeout(function () { if (Page_IsValid) button.disabled = true; }, 0); })(this);"

It's neater to put all of this JavaScript code in its own function as the question shows:

OnClientClick="disable(this);"

function disable(button) {
    setTimeout(function () {
        if (Page_IsValid)
            button.disabled = true;
    }, 0);
}

Disabling the button on the client side doesn't disable it on the server side

To overcome this, disable the button on the server side. For example, in the OnClick event handler:

OnClick="Button1_Click"

protected void Button1_Click(object sender, EventArgs e)
{
    ((Button)sender).Enabled = false;
}

Lastly, keep in mind that preventing duplicate button presses doesn't prevent two different users from submitting the same data at the same time. Make sure to account for that on the server side.

1st way is to use props

<Row id = "someRandomID">

Wherein, in the Definition, you may just go

const Row = props  => {
 div id = {props.id}
}

The same could be done with class, replacing id with className in the above example.

You might as well use react-html-id, that is an npm package. This is an npm package that allows you to use unique html IDs for components without any dependencies on other libraries.

Ref: react-html-id

Peace.

Install svn, navigate to your directory then run the command svn checkout <url-to-repostitory> ..

Please provide us with some details like your operating system and what/where you want to download.

It's really easy. Try the code below,

<RelativeLayout
    android:id="@+id/second_RL"
    android:layout_width="match_parent"
    android:layout_height="match_parent"
    android:layout_below="@+id/first_RL"
    android:background="@android:color/holo_blue_bright"
    android:gravity="center">

    <Button
        android:id="@+id/button"
        android:layout_width="wrap_content"
        android:layout_height="wrap_content"
        android:text="Button" />

</RelativeLayout>

foreach($data as $value)
{
    $value["transaction_date"] = date('d/m/Y',$value["transaction_date"]);
}
return $data;

If you have more than one project in workspace, you need to:

1) add new configuration to all of the projects

2) product -> clean

3) delete derived data

4) pod install in terminal

5) build your project.

Hope it helps to someone.

you can use framelayout to achieve this.

how to use framelayout

<FrameLayout xmlns:android="http://schemas.android.com/apk/res/android"
   android:layout_width="fill_parent"
   android:layout_height="fill_parent">

   <ImageView 
   android:src="@drawable/ic_launcher"
   android:scaleType="fitCenter"
   android:layout_height="250px"
   android:layout_width="250px"/>

   <TextView
   android:text="Frame Demo"
   android:textSize="30px"
   android:textStyle="bold"
   android:layout_height="fill_parent"
   android:layout_width="fill_parent"
   android:gravity="center"/>
</FrameLayout>

ref: tutorialspoint

OK, I have been having the same kind of issue, but I was using Java 8, and kept getting this error, I tried most of the solutions. but it turns out that my maven was still pointing to java 9 even-though I set the global Java version to 8, as soon as I fixed that it all worked.

For anybody who might have this kind of problem, check out How to fix Maven to use default Java

I have also faced the same issue and somehow IIS Express's config file is not pointing to the correct bin directory for the website. So editing the Config file which will be in Documents/IISExpress/config fixed the issue. Just point to the correct physical path in Site tag as shown below.

     <site name="MYWEBSITE" id="4">
            <application path="/" applicationPool="Clr4IntegratedAppPool">
                <virtualDirectory path="/" physicalPath="D:\MYWEBSITE" />
            </application>
            <bindings>
                <binding protocol="https" bindingInformation="*:44305:localhost" />
                <binding protocol="http" bindingInformation="*:6689:localhost" />
            </bindings>
        </site>

• To stop a python script just press Ctrl + C.
• Inside a script with exit(), you can do it.
• You can do it in an interactive script with just exit.
• You can use pkill -f name-of-the-python-script.

You can adjust the width of the popover with methods indicated above, but the best thing to do is to define the width of the content before Bootstrap sees is and does its math. For instance, I had a table, I defined it's width, then bootstrap built a popover to suit it. (Sometimes Bootstrap has trouble determining the width, and you need to step in and hold its hand)

Assuming your data frame is named d,

d[order(as.Date(d$V3, format="%d/%m/%Y")),]

Read my blog post, Sorting a data frame by the contents of a column, if that doesn't make sense.

I was able to create an EntityManager with Hibernate and PostgreSQL purely using Java code (with a Spring configuration) the following:

@Bean
public DataSource dataSource() {
    final PGSimpleDataSource dataSource = new PGSimpleDataSource();

    dataSource.setDatabaseName( "mytestdb" );
    dataSource.setUser( "myuser" );
    dataSource.setPassword("mypass");

    return dataSource;
}

@Bean
public Properties hibernateProperties(){
    final Properties properties = new Properties();

    properties.put( "hibernate.dialect", "org.hibernate.dialect.PostgreSQLDialect" );
    properties.put( "hibernate.connection.driver_class", "org.postgresql.Driver" );
    properties.put( "hibernate.hbm2ddl.auto", "create-drop" );

    return properties;
}

@Bean
public EntityManagerFactory entityManagerFactory( DataSource dataSource, Properties hibernateProperties ){
    final LocalContainerEntityManagerFactoryBean em = new LocalContainerEntityManagerFactoryBean();
    em.setDataSource( dataSource );
    em.setPackagesToScan( "net.initech.domain" );
    em.setJpaVendorAdapter( new HibernateJpaVendorAdapter() );
    em.setJpaProperties( hibernateProperties );
    em.setPersistenceUnitName( "mytestdomain" );
    em.setPersistenceProviderClass(HibernatePersistenceProvider.class);
    em.afterPropertiesSet();

    return em.getObject();
}

The call to LocalContainerEntityManagerFactoryBean.afterPropertiesSet() is essential since otherwise the factory never gets built, and then getObject() returns null and you are chasing after NullPointerExceptions all day long. >:-(

It then worked with the following code:

PageEntry pe = new PageEntry();
pe.setLinkName( "Google" );
pe.setLinkDestination( new URL( "http://www.google.com" ) );

EntityTransaction entTrans = entityManager.getTransaction();
entTrans.begin();
entityManager.persist( pe );
entTrans.commit();

Where my entity was this:

@Entity
@Table(name = "page_entries")
public class PageEntry {

    @Id
    @GeneratedValue(strategy = GenerationType.IDENTITY)
    private long id;

    private String linkName;
    private URL linkDestination;

    // gets & setters omitted
}

I don't see an obvious problem with the above.

It's possible your ldap.conf is being overridden, but the command-line options will take precedence, ldapsearch will ignore BINDDN in the main ldap.conf, so the only parameter that could be wrong is the URI. (The order is ETCDIR/ldap.conf then ~/ldaprc or ~/.ldaprc and then ldaprc in the current directory, though there environment variables which can influence this too, see man ldapconf.)

Try an explicit URI:

ldapsearch -x -W -D 'cn=Manager,dc=example,dc=com' -b "" -s base -H ldap://localhost

or prevent defaults with:

LDAPNOINIT=1 ldapsearch -x -W -D 'cn=Manager,dc=example,dc=com' -b "" -s base

If that doesn't work, then some troubleshooting (you'll probably need the full path to the slapd binary for these):

• make sure your slapd.conf is being used and is correct (as root)

  slapd -T test -f slapd.conf -d 65535

  You may have a left-over or default slapd.d configuration directory which takes preference over your slapd.conf (unless you specify your config explicitly with -f, slapd.conf is officially deprecated in OpenLDAP-2.4). If you don't get several pages of output then your binaries were built without debug support.

• stop OpenLDAP, then manually start slapd in a separate terminal/console with debug enabled (as root, ^C to quit)

  slapd -h ldap://localhost -d 481

  then retry the search and see if you can spot the problem (there will be a lot of schema noise in the start of the output unfortunately). (Note: running slapd without the -u/-g options can change file ownerships which can cause problems, you should usually use those options, probably -u ldap -g ldap )

• if debug is enabled, then try also

  ldapsearch -v -d 63 -W -D 'cn=Manager,dc=example,dc=com' -b "" -s base

This works:

df['date'].dt.year

Now:

df['year'] = df['date'].dt.year
df['month'] = df['date'].dt.month

gives this data frame:

        date  Count  year  month
0 2010-06-30    525  2010      6
1 2010-07-30    136  2010      7
2 2010-08-31    125  2010      8
3 2010-09-30     84  2010      9
4 2010-10-29   4469  2010     10

I have today similar problem. But weirder.

• host - works host pl.archive.ubuntu.com
• dig - works on default and on all other DNS's dig pl.archive.ubuntu.com, dig @127.0.1.1 pl.archive.ubuntu.com
• curl - doesn't work! but for some addresses it does. WEIRD! Same in Ruby, APT and many more.

$ curl -v http://google.com/
*   Trying 172.217.18.78...
* Connected to google.com (172.217.18.78) port 80 (#0)
> GET / HTTP/1.1
> Host: google.com
> User-Agent: curl/7.47.0
> Accept: */*
>
< HTTP/1.1 302 Found
< Cache-Control: private
< Content-Type: text/html; charset=UTF-8
< Referrer-Policy: no-referrer
< Location: http://www.google.pl/?gfe_rd=cr&ei=pt9UWfqXL4uBX_W5n8gB
< Content-Length: 256
< Date: Thu, 29 Jun 2017 11:08:22 GMT
<
<HTML><HEAD><meta http-equiv="content-type" content="text/html;charset=utf-8">
<TITLE>302 Moved</TITLE></HEAD><BODY>
<H1>302 Moved</H1>
The document has moved
<A HREF="http://www.google.pl/?gfe_rd=cr&ei=pt9UWfqXL4uBX_W5n8gB">here</A>.
</BODY></HTML>
* Connection #0 to host google.com left intact

$ curl -v http://pl.archive.ubuntu.com/
* Could not resolve host: pl.archive.ubuntu.com
* Closing connection 0
curl: (6) Could not resolve host: pl.archive.ubuntu.com

Revelation

Eventually I used strace on curl and found that it was connection to nscd deamon.

connect(4, {sa_family=AF_LOCAL, sun_path="/var/run/nscd/socket"}, 110) = 0

Solution

I've restarted the nscd service (Name Service Cache Daemon) and it helped to solve this issue!

systemctl restart nscd.service

in the "Ouput Window". you can usually do CTRL-ALT-O to make it visible. Or through menus using View->Output.

You're trying to use a dict as a key to another dict or in a set. That does not work because the keys have to be hashable. As a general rule, only immutable objects (strings, integers, floats, frozensets, tuples of immutables) are hashable (though exceptions are possible). So this does not work:

>>> dict_key = {"a": "b"}
>>> some_dict[dict_key] = True
Traceback (most recent call last):
  File "<stdin>", line 1, in <module>
TypeError: unhashable type: 'dict'

To use a dict as a key you need to turn it into something that may be hashed first. If the dict you wish to use as key consists of only immutable values, you can create a hashable representation of it like this:

>>> key = frozenset(dict_key.items())

Now you may use key as a key in a dict or set:

>>> some_dict[key] = True
>>> some_dict
{frozenset([('a', 'b')]): True}

Of course you need to repeat the exercise whenever you want to look up something using a dict:

>>> some_dict[dict_key]                     # Doesn't work
Traceback (most recent call last):
  File "<stdin>", line 1, in <module>
TypeError: unhashable type: 'dict'
>>> some_dict[frozenset(dict_key.items())]  # Works
True

If the dict you wish to use as key has values that are themselves dicts and/or lists, you need to recursively "freeze" the prospective key. Here's a starting point:

def freeze(d):
    if isinstance(d, dict):
        return frozenset((key, freeze(value)) for key, value in d.items())
    elif isinstance(d, list):
        return tuple(freeze(value) for value in d)
    return d

$(document).ready(function () {
        $("#tbl_Customer tbody tr .companyname").click(function () {

            var comapnyname = $(this).closest(".trclass").find(".companyname").text();
            var CompanyAddress = $(this).closest(".trclass").find(".CompanyAddress").text();
            var CompanyEmail = $(this).closest(".trclass").find(".CompanyEmail").text();
            var CompanyContactNumber = $(this).closest(".trclass").find(".CompanyContactNumber").text();
            var CompanyContactPerson = $(this).closest(".trclass").find(".CompanyContactPerson").text();
           // var clickedCell = $(this);
            alert(comapnyname);
            alert(CompanyAddress);
            alert(CompanyEmail);
            alert(CompanyContactNumber);
            alert(CompanyContactPerson);

            //alert(clickedCell.text());
        });
    });

Another way is injecting org.springframework.core.env.Environment to your bean.

@Autowired
private Environment env;
....

public void method() {
    .....  
    String path = env.getProperty("userBucket.path");
    .....
}

For posterity....I figured out how to get what I needed. Here it is in case it might be useful to somebody else.

$alist = "Name`tAccountName`tDescription`tEmailAddress`tLastLogonDate`tManager`tTitle`tDepartment`tCompany`twhenCreated`tAcctEnabled`tGroups`n"
$userlist = Get-ADUser -Filter * -Properties * | Select-Object -Property Name,SamAccountName,Description,EmailAddress,LastLogonDate,Manager,Title,Department,Company,whenCreated,Enabled,MemberOf | Sort-Object -Property Name
$userlist | ForEach-Object {
    $grps = $_.MemberOf | Get-ADGroup | ForEach-Object {$_.Name} | Sort-Object
    $arec = $_.Name,$_.SamAccountName,$_.Description,$_.EmailAddress,$_LastLogonDate,$_.Manager,$_.Title,$_.Department,$_.Company,$_.whenCreated,$_.Enabled
    $aline = ($arec -join "`t") + "`t" + ($grps -join "`t") + "`n"
    $alist += $aline
}
$alist | Out-File D:\Temp\ADUsers.csv

To change the port

npm start --port 8000

fyi, this can happen if you are using the html type="number" attribute on your input tag. Entering a non-number will clear it before your script knows what's going on.

If it's not a big/long array just mirror it:

for( int i = 0; i < arr.length/2; ++i ) 
{ 
  temp = arr[i]; 
  arr[i] = arr[arr.length - i - 1]; 
  arr[arr.length - i - 1] = temp; 
}

A little bit off topic maybe, but for modern browsers (IE9 and newer) you can use the css odd/even selectors to achieve want you want.

tr:nth-child(even) { /* your alt-row stuff */}
tr:nth-child(odd) { /* the other rows */ }

or

tr { /* all table rows */ }
tr:nth-child(even) { /* your alt-row stuff */}

Try this code


 <div id="recommended-item-carousel" class="carousel slide" data-ride="carousel">
    <div class="carousel-inner">
        <div class="item active">

            <div class="col-sm-3">
                <div class="product-image-wrapper">
                    <div class="single-products">
                        <div class="productinfo text-center">
                            <img src="img/home/recommend1.jpg" alt="" />
                            <h2>$56</h2>
                            <p>
                                Easy Polo Black Edition
                            </p>
                            <a href="#" class="btn btn-default add-to-cart"><i class="fa fa-shopping-cart"></i>Add to cart</a>
                        </div>

                    </div>
                </div>
            </div>
            <div class="col-sm-3">
                <div class="product-image-wrapper">
                    <div class="single-products">
                        <div class="productinfo text-center">
                            <img src="img/home/recommend2.jpg" alt="" />
                            <h2>$56</h2>
                            <p>
                                Easy Polo Black Edition
                            </p>
                            <a href="#" class="btn btn-default add-to-cart"><i class="fa fa-shopping-cart"></i>Add to cart</a>
                        </div>

                    </div>
                </div>
            </div>
            <div class="col-sm-3">
                <div class="product-image-wrapper">
                    <div class="single-products">
                        <div class="productinfo text-center">
                            <img src="img/home/recommend3.jpg" alt="" />
                            <h2>$56</h2>
                            <p>
                                Easy Polo Black Edition
                            </p>
                            <a href="#" class="btn btn-default add-to-cart"><i class="fa fa-shopping-cart"></i>Add to cart</a>
                        </div>

                    </div>
                </div>
            </div>
        </div>
        <div class="item">
            <div class="col-sm-3">
                <div class="product-image-wrapper">
                    <div class="single-products">
                        <div class="productinfo text-center">
                            <img src="img/home/recommend1.jpg" alt="" />
                            <h2>$56</h2>
                            <p>
                                Easy Polo Black Edition
                            </p>
                            <a href="#" class="btn btn-default add-to-cart"><i class="fa fa-shopping-cart"></i>Add to cart</a>
                        </div>

                    </div>
                </div>
            </div>
            <div class="col-sm-3">
                <div class="product-image-wrapper">
                    <div class="single-products">
                        <div class="productinfo text-center">
                            <img src="img/home/recommend2.jpg" alt="" />
                            <h2>$56</h2>
                            <p>
                                Easy Polo Black Edition
                            </p>
                            <a href="#" class="btn btn-default add-to-cart"><i class="fa fa-shopping-cart"></i>Add to cart</a>
                        </div>

                    </div>
                </div>
            </div>
            <div class="col-sm-3">
                <div class="product-image-wrapper">
                    <div class="single-products">
                        <div class="productinfo text-center">
                            <img src="img/home/recommend3.jpg" alt="" />
                            <h2>$56</h2>
                            <p>
                                Easy Polo Black Edition
                            </p>
                            <a href="#" class="btn btn-default add-to-cart"><i class="fa fa-shopping-cart"></i>Add to cart</a>
                        </div>

                    </div>
                </div>
            </div>
        </div>
    </div>
    <a class="left recommended-item-control" href="#recommended-item-carousel" data-slide="prev"> <i class="fa fa-angle-left"></i> </a>
    <a class="right recommended-item-control" href="#recommended-item-carousel" data-slide="next"> <i class="fa fa-angle-right"></i> </a>
</div>

Using python to calculate this, for example(written in python 3), 50% transparency :

hex(round(256*0.50))

:)

For django 1.10 you may have to do python manage.py makemigrations appname.

I see that this question is already old but still...

We made a sipmle library at our company for achieving what is desired - An interactive info window with views and everything. You can check it out on github.

I hope it helps :)

There are two ways. The easy one is to use the -run flag and provide a pattern matching names of the tests you want to run.

Example:

$ go test -run NameOfTest

See the docs for more info.

The other way is to name the specific file, containing the tests you want to run:

$ go test foo_test.go

But there's a catch. This works well if:

• foo.go is in package foo.
• foo_test.go is in package foo_test and imports 'foo'.

If foo_test.go and foo.go are the same package (a common case) then you must name all other files required to build foo_test. In this example it would be:

$ go test foo_test.go foo.go

I'd recommend to use the -run pattern. Or, where/when possible, always run all package tests.

Here is my step by step experience, inspired by typeahead examples, from a Scala/PlayFramework app we are working on.

In a script LearnerNameTypeAhead.coffee (convertible of course to JS) I have:

$ ->
  learners = new Bloodhound(
    datumTokenizer: Bloodhound.tokenizers.obj.whitespace("value")
    queryTokenizer: Bloodhound.tokenizers.whitespace
    remote: "/learner/namelike?nameLikeStr=%QUERY"
  )
  learners.initialize()
  $("#firstName").typeahead 
    minLength: 3
    hint: true
    highlight:true
   ,
    name: "learners"
    displayKey: "value"
    source: learners.ttAdapter()

I included the typeahead bundle and my script on the page, and there is a div around my input field as follows:

<script [email protected]("javascripts/typeahead.bundle.js")></script>
<script [email protected]("javascripts/LearnerNameTypeAhead.js") type="text/javascript" ></script>
<div>
  <input name="firstName" id="firstName" class="typeahead" placeholder="First Name" value="@firstName">
</div>

The result is that for each character typed in the input field after the first minLength (3) characters, the page issues a GET request with a URL looking like /learner/namelike?nameLikeStr= plus the currently typed characters. The server code returns a json array of objects containing fields "id" and "value", for example like this:

[ {
    "id": "109",
    "value": "Graham Jones"
  },
  {
    "id": "5833",
    "value": "Hezekiah Jones"
} ]

For play I need something in the routes file:

GET /learner/namelike controllers.Learners.namesLike(nameLikeStr:String)

And finally, I set some of the styling for the dropdown, etc. in a new typeahead.css file which I included in the page's <head> (or accessible .css)

.tt-dropdown-menu {
  width: 252px;
  margin-top: 12px;
  padding: 8px 0;
  background-color: #fff;
  border: 1px solid #ccc;
  border: 1px solid rgba(0, 0, 0, 0.2);
  -webkit-border-radius: 8px;
     -moz-border-radius: 8px;
          border-radius: 8px;
  -webkit-box-shadow: 0 5px 10px rgba(0,0,0,.2);
     -moz-box-shadow: 0 5px 10px rgba(0,0,0,.2);
          box-shadow: 0 5px 10px rgba(0,0,0,.2);
}
.typeahead {
  background-color: #fff;
}
.typeahead:focus {
  border: 2px solid #0097cf;
}
.tt-query {
  -webkit-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075);
     -moz-box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075);
          box-shadow: inset 0 1px 1px rgba(0, 0, 0, 0.075);
}
.tt-hint {
  color: #999
}
.tt-suggestion {
  padding: 3px 20px;
  font-size: 18px;
  line-height: 24px;
}
.tt-suggestion.tt-cursor {
  color: #fff;
  background-color: #0097cf;
}
.tt-suggestion p {
  margin: 0;
}

What you want to do is not possible in a sane way. There was a similar question so look at the answers.

Then there's also an insane approach (site down - backup available here.) written by Jeffrey Knight:

Question: How do I create an application that can run in either GUI (windows) mode or command line / console mode?

On the surface of it, this would seem easy: you create a Console application, add a windows form to it, and you're off and running. However, there's a problem:

Problem: If you run in GUI mode, you end up with both a window and a pesky console lurking in the background, and you don't have any way to hide it.

What people seem to want is a true amphibian application that can run smoothly in either mode.

If you break it down, there are actually four use cases here:

User starts application from existing cmd window, and runs in GUI mode
User double clicks to start application, and runs in GUI mode
User starts application from existing cmd window, and runs in command mode
User double clicks to start application, and runs in command mode.

I'm posting the code to do this, but with a caveat.

I actually think this sort of approach will run you into a lot more trouble down the road than it's worth. For example, you'll have to have two different UIs' -- one for the GUI and one for the command / shell. You're going to have to build some strange central logic engine that abstracts from GUI vs. command line, and it's just going to get weird. If it were me, I'd step back and think about how this will be used in practice, and whether this sort of mode-switching is worth the work. Thus, unless some special case called for it, I wouldn't use this code myself, because as soon as I run into situations where I need API calls to get something done, I tend to stop and ask myself "am I overcomplicating things?".

Output type=Windows Application

using System;
using System.Collections.Generic;
using System.Windows.Forms;
using System.Runtime.InteropServices;
using System.Diagnostics;
using Microsoft.Win32;

namespace WindowsApplication
{
    static class Program
    {
        /*
    DEMO CODE ONLY: In general, this approach calls for re-thinking 
    your architecture!
    There are 4 possible ways this can run:
    1) User starts application from existing cmd window, and runs in GUI mode
    2) User double clicks to start application, and runs in GUI mode
    3) User starts applicaiton from existing cmd window, and runs in command mode
    4) User double clicks to start application, and runs in command mode.

    To run in console mode, start a cmd shell and enter:
        c:\path\to\Debug\dir\WindowsApplication.exe console
        To run in gui mode,  EITHER just double click the exe, OR start it from the cmd prompt with:
        c:\path\to\Debug\dir\WindowsApplication.exe (or pass the "gui" argument).
        To start in command mode from a double click, change the default below to "console".
    In practice, I'm not even sure how the console vs gui mode distinction would be made from a
    double click...
        string mode = args.Length > 0 ? args[0] : "console"; //default to console
    */

        [DllImport("kernel32.dll", SetLastError = true)]
        static extern bool AllocConsole();

        [DllImport("kernel32.dll", SetLastError = true)]
        static extern bool FreeConsole();

        [DllImport("kernel32", SetLastError = true)]
        static extern bool AttachConsole(int dwProcessId);

        [DllImport("user32.dll")]
        static extern IntPtr GetForegroundWindow();

        [DllImport("user32.dll", SetLastError = true)]
        static extern uint GetWindowThreadProcessId(IntPtr hWnd, out int lpdwProcessId);

        [STAThread]
        static void Main(string[] args)
        {
            //TODO: better handling of command args, (handle help (--help /?) etc.)
            string mode = args.Length > 0 ? args[0] : "gui"; //default to gui

            if (mode == "gui")
            {
                MessageBox.Show("Welcome to GUI mode");

                Application.EnableVisualStyles();

                Application.SetCompatibleTextRenderingDefault(false);

                Application.Run(new Form1());
            }
            else if (mode == "console")
            {

                //Get a pointer to the forground window.  The idea here is that
                //IF the user is starting our application from an existing console
                //shell, that shell will be the uppermost window.  We'll get it
                //and attach to it
                IntPtr ptr = GetForegroundWindow();

                int  u;

                GetWindowThreadProcessId(ptr, out u);

                Process process = Process.GetProcessById(u);

                if (process.ProcessName == "cmd" )    //Is the uppermost window a cmd process?
                {
                    AttachConsole(process.Id);

                    //we have a console to attach to ..
                    Console.WriteLine("hello. It looks like you started me from an existing console.");
                }
                else
                {
                    //no console AND we're in console mode ... create a new console.

                    AllocConsole();

                    Console.WriteLine(@"hello. It looks like you double clicked me to start
                   AND you want console mode.  Here's a new console.");
                    Console.WriteLine("press any key to continue ...");
                    Console.ReadLine();       
                }

                FreeConsole();
            }
        }
    }
}

The JavaScript style names are WebkitTransformOrigin and WebkitTransform

element.style.webkitTransform = "rotate(-2deg)";

Check the DOM extension reference for WebKit here.

Use £. I had the same problem and solved it using jQuery:

$(this).text('£');

• If you try this and it does not work, just change the jQuery methods,

$(this).html('£');

• This always work in all contexts...

I think the wait/notify/notifyAll methods don't belong on the Object class as it pollutes all objects with methods that are rarely used. They make much more sense on a dedicated Lock class. So from this point of view, perhaps it's better to use a tool that is explicitly designed for the job at hand - ie ReentrantLock.

You could simply check for the existence of an empty file, if it doesn't exist, then execute your code and create the file.

e.g.

if(File.Exists("emptyfile"){
    //Your code here
    File.Create("emptyfile");
}

Windows-> Start -> Turn widows features on and off

Make sure you check required options in

If you have an existing list and you want to loop over it and keep track of the indices you can use the enumerate function. For example

l = ["apple", "pear", "banana"]
for i, fruit in enumerate(l):
   print "index", i, "is", fruit

Apache Commons has an IntegerValidator class which appears to do what you want. Java provides no in-built method for doing this.

See here for the groupid/artifactid.

If none of the solutions worked for you, quickly read this answer [might be your case]:

For those of you like me who went through all of these [great] answers but still have trouble pushing your commits, there is potentially one other reason for failure of a push.

Check your git repository (wherever it is, GitHub, BitBucket, ...) to see if everything is OK. In my case, after spending a lot of time figuring out what my problem is (even blaming PyCharm's new edition! :) ) I realized that I did some stupid things and my BitBucket repo exceeded the 2GB limit and automatically turned to a read-only repo and that was why I could not push any new commit. And, that exactly causes you getting the same error (403: unable to access the URL.)

See the exec maven plugin. You can run Java classes using:

mvn exec:java -Dexec.mainClass="com.example.Main" [-Dexec.args="argument1"] ...

The invocation can be as simple as mvn exec:java if the plugin configuration is in your pom.xml. The plugin site on Mojohaus has a more detailed example.

<project>
    <build>
        <plugins>
            <plugin>
                <groupId>org.codehaus.mojo</groupId>
                <artifactId>exec-maven-plugin</artifactId>
                <version>1.2.1</version>
                <configuration>
                    <mainClass>com.example.Main</mainClass>
                    <arguments>
                        <argument>argument1</argument>
                    </arguments>
                </configuration>
            </plugin>
        </plugins>
    </build>
</project>